BLASTX nr result
ID: Cnidium21_contig00015237
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00015237 (572 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510641.1| conserved hypothetical protein [Ricinus comm... 102 4e-20 ref|XP_003540566.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1... 99 4e-19 ref|XP_004145533.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1... 99 5e-19 gb|AFK49070.1| unknown [Lotus japonicus] 99 6e-19 ref|XP_003607260.1| hypothetical protein MTR_4g075160 [Medicago ... 98 8e-19 >ref|XP_002510641.1| conserved hypothetical protein [Ricinus communis] gi|223551342|gb|EEF52828.1| conserved hypothetical protein [Ricinus communis] Length = 69 Score = 102 bits (254), Expect = 4e-20 Identities = 40/44 (90%), Positives = 44/44 (100%) Frame = +1 Query: 133 VTIHQPKRWHSVTGKGMCAMMWFWILYRAKKDGPVVLGWRHPWE 264 VTIHQPKRWHS+TGKG+CA+MWFWILYRAK+DGPVVLGWRHPWE Sbjct: 14 VTIHQPKRWHSITGKGLCAVMWFWILYRAKQDGPVVLGWRHPWE 57 >ref|XP_003540566.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2 [Glycine max] Length = 67 Score = 99.4 bits (246), Expect = 4e-19 Identities = 37/44 (84%), Positives = 43/44 (97%) Frame = +1 Query: 133 VTIHQPKRWHSVTGKGMCAMMWFWILYRAKKDGPVVLGWRHPWE 264 VTIHQPKRWH++TGKG+CA+MWFW+ YRAK+DGPVVLGWRHPWE Sbjct: 14 VTIHQPKRWHTITGKGLCAVMWFWVFYRAKQDGPVVLGWRHPWE 57 >ref|XP_004145533.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2-like isoform 1 [Cucumis sativus] gi|449455587|ref|XP_004145534.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2-like isoform 2 [Cucumis sativus] gi|449485133|ref|XP_004157078.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2-like isoform 1 [Cucumis sativus] gi|449485137|ref|XP_004157079.1| PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2-like isoform 2 [Cucumis sativus] Length = 69 Score = 99.0 bits (245), Expect = 5e-19 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = +1 Query: 133 VTIHQPKRWHSVTGKGMCAMMWFWILYRAKKDGPVVLGWRHPWE 264 VTIH PKRWH+VTGKG+CA+MWFW+LYRAK+DGPVVLGWRHPWE Sbjct: 15 VTIHPPKRWHTVTGKGLCAVMWFWVLYRAKQDGPVVLGWRHPWE 58 >gb|AFK49070.1| unknown [Lotus japonicus] Length = 66 Score = 98.6 bits (244), Expect = 6e-19 Identities = 37/44 (84%), Positives = 43/44 (97%) Frame = +1 Query: 133 VTIHQPKRWHSVTGKGMCAMMWFWILYRAKKDGPVVLGWRHPWE 264 VT+H PKRWH+VTGKG+CA+MWFW+LYRAK+DGPVVLGWRHPWE Sbjct: 14 VTVHTPKRWHAVTGKGLCAVMWFWVLYRAKQDGPVVLGWRHPWE 57 >ref|XP_003607260.1| hypothetical protein MTR_4g075160 [Medicago truncatula] gi|355508315|gb|AES89457.1| hypothetical protein MTR_4g075160 [Medicago truncatula] Length = 84 Score = 98.2 bits (243), Expect = 8e-19 Identities = 37/44 (84%), Positives = 43/44 (97%) Frame = +1 Query: 133 VTIHQPKRWHSVTGKGMCAMMWFWILYRAKKDGPVVLGWRHPWE 264 VTIHQPKRWH+VTGKG+CA+MWFW++YRAK+D PVVLGWRHPWE Sbjct: 17 VTIHQPKRWHTVTGKGLCAVMWFWVMYRAKQDAPVVLGWRHPWE 60