BLASTX nr result
ID: Cnidium21_contig00015216
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00015216 (397 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAD07011.1| peroxidase [Coffea arabica] 81 1e-13 ref|XP_002524316.1| Peroxidase 12 precursor, putative [Ricinus c... 80 1e-13 gb|AEX20389.1| putative class III peroxidase [Coffea arabica x C... 80 2e-13 emb|CAP72490.1| catharanthus roseus peroxidase 2b [Catharanthus ... 79 4e-13 emb|CAP72489.1| catharanthus roseus peroxidase 2a [Catharanthus ... 79 4e-13 >dbj|BAD07011.1| peroxidase [Coffea arabica] Length = 217 Score = 80.9 bits (198), Expect = 1e-13 Identities = 38/51 (74%), Positives = 46/51 (90%) Frame = +3 Query: 3 NQTLFFEKFVIGMLKMGQLNVLTGTQGEIRANCSMRNSDNTLLSSVVDVAE 155 NQ+LFFEKFV M+KMGQLNVLTGT+GEIRANCS+RNSDN+ LS+ V++ E Sbjct: 161 NQSLFFEKFVDAMIKMGQLNVLTGTRGEIRANCSVRNSDNSFLSTGVEMGE 211 >ref|XP_002524316.1| Peroxidase 12 precursor, putative [Ricinus communis] gi|223536407|gb|EEF38056.1| Peroxidase 12 precursor, putative [Ricinus communis] Length = 216 Score = 80.5 bits (197), Expect = 1e-13 Identities = 37/48 (77%), Positives = 44/48 (91%) Frame = +3 Query: 3 NQTLFFEKFVIGMLKMGQLNVLTGTQGEIRANCSMRNSDNTLLSSVVD 146 NQ+LFFEKFV M+KMGQL+VLTGTQGE+RANCS+RNSDNT L +VV+ Sbjct: 159 NQSLFFEKFVFSMIKMGQLSVLTGTQGEVRANCSVRNSDNTYLVTVVE 206 >gb|AEX20389.1| putative class III peroxidase [Coffea arabica x Coffea canephora] Length = 274 Score = 79.7 bits (195), Expect = 2e-13 Identities = 37/51 (72%), Positives = 46/51 (90%) Frame = +3 Query: 3 NQTLFFEKFVIGMLKMGQLNVLTGTQGEIRANCSMRNSDNTLLSSVVDVAE 155 NQ+LFFEKFV M+KMGQLNVLTGT+GEIRANCS+RNSDN+ LS+ V++ + Sbjct: 218 NQSLFFEKFVDAMIKMGQLNVLTGTRGEIRANCSVRNSDNSFLSTGVEMGQ 268 >emb|CAP72490.1| catharanthus roseus peroxidase 2b [Catharanthus roseus] gi|187453122|emb|CAP72492.1| peroxidase 2b precursor [Catharanthus roseus] Length = 365 Score = 79.0 bits (193), Expect = 4e-13 Identities = 38/55 (69%), Positives = 46/55 (83%) Frame = +3 Query: 3 NQTLFFEKFVIGMLKMGQLNVLTGTQGEIRANCSMRNSDNTLLSSVVDVAEEASQ 167 NQTLFFEKFV M+KMGQLNVLTG QGEIRANCS+RN+ + SS+V V E+A++ Sbjct: 305 NQTLFFEKFVYAMIKMGQLNVLTGNQGEIRANCSVRNAASGRSSSLVSVVEDAAE 359 >emb|CAP72489.1| catharanthus roseus peroxidase 2a [Catharanthus roseus] gi|187453120|emb|CAP72491.1| peroxidase 2a precursor [Catharanthus roseus] Length = 360 Score = 79.0 bits (193), Expect = 4e-13 Identities = 38/55 (69%), Positives = 46/55 (83%) Frame = +3 Query: 3 NQTLFFEKFVIGMLKMGQLNVLTGTQGEIRANCSMRNSDNTLLSSVVDVAEEASQ 167 NQTLFFEKFV M+KMGQLNVLTG QGEIRANCS+RN+ + SS+V V E+A++ Sbjct: 300 NQTLFFEKFVYAMIKMGQLNVLTGNQGEIRANCSVRNAASGRSSSLVSVVEDAAE 354