BLASTX nr result
ID: Cnidium21_contig00015192
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00015192 (271 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532375.1| basic helix-loop-helix-containing protein, p... 50 4e-06 >ref|XP_002532375.1| basic helix-loop-helix-containing protein, putative [Ricinus communis] gi|223527931|gb|EEF30018.1| basic helix-loop-helix-containing protein, putative [Ricinus communis] Length = 749 Score = 50.1 bits (118), Expect(2) = 4e-06 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = +1 Query: 4 DGWLTQYSAGIRTTAVVAVYPHGVVQLGYFSSV 102 DGW +Q+SAGIRT VVAV PHGVVQLG + V Sbjct: 120 DGWQSQFSAGIRTIIVVAVVPHGVVQLGSLNKV 152 Score = 25.4 bits (54), Expect(2) = 4e-06 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +3 Query: 108 ISEDLNLVNHIRDSMVELHEN 170 ++ED+ LVNHI+D L ++ Sbjct: 152 VAEDMKLVNHIKDVFSSLQDS 172