BLASTX nr result
ID: Cnidium21_contig00015067
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00015067 (477 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004222348.1| hypothetical protein BevumaM_p115 [Beta vulg... 132 3e-29 ref|NP_064106.1| orf124 gene product (mitochondrion) [Beta vulga... 130 8e-29 ref|YP_173454.1| hypothetical protein NitaMp116 [Nicotiana tabac... 78 7e-13 >ref|YP_004222348.1| hypothetical protein BevumaM_p115 [Beta vulgaris subsp. maritima] gi|346683221|ref|YP_004842153.1| hypothetical protein BemaM_p109 [Beta macrocarpa] gi|317905684|emb|CBJ14078.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439863|emb|CBJ17568.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148079|emb|CBJ20741.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500139|emb|CBX24958.1| hypothetical protein [Beta macrocarpa] gi|384939171|emb|CBL52018.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 124 Score = 132 bits (332), Expect = 3e-29 Identities = 60/84 (71%), Positives = 66/84 (78%) Frame = -2 Query: 383 DASSAPLFMNDLFNSICHEYSKYAHSTGRVLPPTWTMPDLVRTVFGEEGLTQDSLRDAYY 204 DA SAP ++ LF IC EYS+Y H GRVLPP WTMPDLVRTV G+E L Q L DAYY Sbjct: 40 DAQSAPSGLDQLFPEICDEYSRYVHEAGRVLPPEWTMPDLVRTVLGDEALQQGFLTDAYY 99 Query: 203 DVMICGTRSWGCEEVLNLLDLINY 132 DVM+CGT SWGCEE+LNLLDLINY Sbjct: 100 DVMLCGTHSWGCEELLNLLDLINY 123 >ref|NP_064106.1| orf124 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|9087356|dbj|BAA99500.1| orf124 [Beta vulgaris subsp. vulgaris] Length = 124 Score = 130 bits (328), Expect = 8e-29 Identities = 59/84 (70%), Positives = 65/84 (77%) Frame = -2 Query: 383 DASSAPLFMNDLFNSICHEYSKYAHSTGRVLPPTWTMPDLVRTVFGEEGLTQDSLRDAYY 204 DA SAP ++ F IC EYS+Y H GRVLPP WTMPDLVRTV G+E L Q L DAYY Sbjct: 40 DAQSAPSGLDQFFPEICDEYSRYVHEAGRVLPPEWTMPDLVRTVLGDEALQQGFLTDAYY 99 Query: 203 DVMICGTRSWGCEEVLNLLDLINY 132 DVM+CGT SWGCEE+LNLLDLINY Sbjct: 100 DVMLCGTHSWGCEELLNLLDLINY 123 >ref|YP_173454.1| hypothetical protein NitaMp116 [Nicotiana tabacum] gi|56806618|dbj|BAD83519.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 125 Score = 78.2 bits (191), Expect = 7e-13 Identities = 38/86 (44%), Positives = 53/86 (61%), Gaps = 1/86 (1%) Frame = -2 Query: 383 DASSAPLFMNDLFNSICHEYSKYAHSTGRVLPPTWTMPDLVRTVFGEEG-LTQDSLRDAY 207 DA SAP + LF+ IC + ++ GR LPP W + DL++ V G+E L L+D Y Sbjct: 39 DAQSAPPELTQLFDGICQKSAELLRLRGRELPPEWNIADLIQAVMGDEAFLIPGHLQDTY 98 Query: 206 YDVMICGTRSWGCEEVLNLLDLINYV 129 YDV++ G SW E++ + LDLINYV Sbjct: 99 YDVLLRGCSSWLLEDLFHFLDLINYV 124