BLASTX nr result
ID: Cnidium21_contig00014914
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00014914 (594 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002444345.1| hypothetical protein SORBIDRAFT_07g020510 [S... 55 9e-06 >ref|XP_002444345.1| hypothetical protein SORBIDRAFT_07g020510 [Sorghum bicolor] gi|241940695|gb|EES13840.1| hypothetical protein SORBIDRAFT_07g020510 [Sorghum bicolor] Length = 533 Score = 55.1 bits (131), Expect = 9e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 410 LCSENASLLPLTRIESRRVIQISVGFMIFFSVLG 309 +CSENA LL LT + SRRV+QIS GFMIFFS+LG Sbjct: 349 ICSENAGLLALTHVGSRRVVQISAGFMIFFSILG 382