BLASTX nr result
ID: Cnidium21_contig00014715
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00014715 (293 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525029.1| conserved hypothetical protein [Ricinus comm... 70 1e-10 ref|XP_002525028.1| conserved hypothetical protein [Ricinus comm... 65 8e-09 >ref|XP_002525029.1| conserved hypothetical protein [Ricinus communis] gi|223535691|gb|EEF37356.1| conserved hypothetical protein [Ricinus communis] Length = 70 Score = 70.5 bits (171), Expect = 1e-10 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 1/70 (1%) Frame = +1 Query: 67 MFQKRTLSIALVWLLVAASIMMCTDAGADSPKNA-DQRFPSLAGCRCCNFIRVKGFIQCG 243 M +K L IAL W LV S+ +C +A A A D+ AGCRCC FI +++CG Sbjct: 1 MVRKEKLFIALTWFLVVMSVAICANATAGPRLQASDEHMELPAGCRCCYFIGQIPYMRCG 60 Query: 244 TVCCKDGCCG 273 VCC+DGCCG Sbjct: 61 MVCCQDGCCG 70 >ref|XP_002525028.1| conserved hypothetical protein [Ricinus communis] gi|223535690|gb|EEF37355.1| conserved hypothetical protein [Ricinus communis] Length = 72 Score = 64.7 bits (156), Expect = 8e-09 Identities = 32/69 (46%), Positives = 40/69 (57%), Gaps = 1/69 (1%) Frame = +1 Query: 67 MFQKRTLSIALVWLLVAASIMMCTDAGADSP-KNADQRFPSLAGCRCCNFIRVKGFIQCG 243 M +K L IAL W LV SI +C +A A + ++ AGCRCC FI I+CG Sbjct: 1 MVRKEKLFIALTWFLVVMSIAICANATAGPRLQTSEHMVQPQAGCRCCFFIGRIPNIRCG 60 Query: 244 TVCCKDGCC 270 VCC+DGCC Sbjct: 61 NVCCEDGCC 69