BLASTX nr result
ID: Cnidium21_contig00014663
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00014663 (621 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN76041.1| hypothetical protein VITISV_002168 [Vitis vinifera] 75 1e-11 ref|XP_003634204.1| PREDICTED: probable FKBP-type peptidyl-proly... 72 1e-10 ref|XP_002532494.1| FK506 binding protein, putative [Ricinus com... 65 1e-08 ref|XP_002318521.1| predicted protein [Populus trichocarpa] gi|2... 65 1e-08 ref|XP_004137497.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 64 2e-08 >emb|CAN76041.1| hypothetical protein VITISV_002168 [Vitis vinifera] Length = 257 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -2 Query: 125 RPGDLVVIDLKGSVQGSDKAFVDTFDGDKRPLAIFMGSRPY 3 RPGDLVVIDLKGSVQGS + FVDTFDG+K+PLA+ MGSRPY Sbjct: 153 RPGDLVVIDLKGSVQGSGEVFVDTFDGEKKPLALVMGSRPY 193 >ref|XP_003634204.1| PREDICTED: probable FKBP-type peptidyl-prolyl cis-trans isomerase 5, chloroplastic-like [Vitis vinifera] gi|297734309|emb|CBI15556.3| unnamed protein product [Vitis vinifera] Length = 258 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 125 RPGDLVVIDLKGSVQGSDKAFVDTFDGDKRPLAIFMGSRPY 3 RPGDLVVIDLKGSVQGS + FVDTFDG+K+ LA+ MGSRPY Sbjct: 154 RPGDLVVIDLKGSVQGSGEVFVDTFDGEKKSLALVMGSRPY 194 >ref|XP_002532494.1| FK506 binding protein, putative [Ricinus communis] gi|223527793|gb|EEF29893.1| FK506 binding protein, putative [Ricinus communis] Length = 266 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/44 (72%), Positives = 36/44 (81%), Gaps = 3/44 (6%) Frame = -2 Query: 125 RPGDLVVIDLKGSVQGSDKAFVDTFDGD---KRPLAIFMGSRPY 3 RPGDLVVIDLKG V+GS + FVDTF GD K+PLA+ MGSRPY Sbjct: 159 RPGDLVVIDLKGRVEGSGQVFVDTFGGDMNKKKPLALVMGSRPY 202 >ref|XP_002318521.1| predicted protein [Populus trichocarpa] gi|222859194|gb|EEE96741.1| predicted protein [Populus trichocarpa] Length = 258 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -2 Query: 125 RPGDLVVIDLKGSVQGSDKAFVDTFDGDKRPLAIFMGSRPY 3 + GDLVVIDLKG ++GS + FVDTF GD++PLA+ MGSRPY Sbjct: 154 KTGDLVVIDLKGKIEGSGEVFVDTFGGDRKPLALVMGSRPY 194 >ref|XP_004137497.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP17-2, chloroplastic-like [Cucumis sativus] Length = 252 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -2 Query: 125 RPGDLVVIDLKGSVQGSDKAFVDTFDGDKRPLAIFMGSRPY 3 R GDLVVIDLKG +QG+D+ FVDTF +++PLA+ MGSRPY Sbjct: 148 RTGDLVVIDLKGKIQGTDEVFVDTFGKERKPLALVMGSRPY 188