BLASTX nr result
ID: Cnidium21_contig00014505
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00014505 (583 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529997.1| cystathionine gamma-synthase, putative [Rici... 158 7e-37 pdb|1QGN|A Chain A, Cystathionine Gamma-Synthase From Nicotiana ... 158 7e-37 gb|AAC19395.1| cystathionine gamma-synthase [Mesembryanthemum cr... 156 2e-36 emb|CAA04772.2| cystathionine gamma synthase [Fragaria vesca] gi... 155 4e-36 gb|AAF74982.1|AF082892_1 cystathionine gamma-synthase isoform 2 ... 155 5e-36 >ref|XP_002529997.1| cystathionine gamma-synthase, putative [Ricinus communis] gi|223530476|gb|EEF32359.1| cystathionine gamma-synthase, putative [Ricinus communis] Length = 425 Score = 158 bits (399), Expect = 7e-37 Identities = 78/88 (88%), Positives = 82/88 (93%) Frame = +1 Query: 319 FCRSDGSIAIHAGERLGRGIVTDAITTPIVNTSAYFFKKTSELIDFKEGRYSSFEYGRYG 498 F SDGSIA+HAGERLGRGIVTDAITTP+VNTSAYFFKKT ELIDFKE R SFEYGRYG Sbjct: 33 FLSSDGSIAVHAGERLGRGIVTDAITTPVVNTSAYFFKKTQELIDFKEKRSVSFEYGRYG 92 Query: 499 NPTTVVAEQKISALEGAESTLLMASGMC 582 NPTTVVAE+KISALEGAESTL+MASGMC Sbjct: 93 NPTTVVAEEKISALEGAESTLIMASGMC 120 >pdb|1QGN|A Chain A, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822271|pdb|1QGN|B Chain B, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822272|pdb|1QGN|C Chain C, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822273|pdb|1QGN|D Chain D, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822274|pdb|1QGN|E Chain E, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822275|pdb|1QGN|F Chain F, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822276|pdb|1QGN|G Chain G, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822277|pdb|1QGN|H Chain H, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|15826471|pdb|1I41|A Chain A, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826472|pdb|1I41|B Chain B, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826473|pdb|1I41|C Chain C, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826474|pdb|1I41|D Chain D, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826475|pdb|1I41|E Chain E, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826476|pdb|1I41|F Chain F, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826477|pdb|1I41|G Chain G, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826478|pdb|1I41|H Chain H, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826479|pdb|1I41|I Chain I, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826480|pdb|1I41|J Chain J, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826481|pdb|1I41|K Chain K, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826482|pdb|1I41|L Chain L, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826483|pdb|1I43|A Chain A, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826484|pdb|1I43|B Chain B, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826485|pdb|1I43|C Chain C, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826486|pdb|1I43|D Chain D, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826487|pdb|1I43|E Chain E, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826488|pdb|1I43|F Chain F, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826489|pdb|1I43|G Chain G, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826490|pdb|1I43|H Chain H, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826491|pdb|1I43|I Chain I, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826492|pdb|1I43|J Chain J, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826493|pdb|1I43|K Chain K, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826494|pdb|1I43|L Chain L, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826495|pdb|1I48|A Chain A, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826496|pdb|1I48|B Chain B, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826497|pdb|1I48|C Chain C, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826498|pdb|1I48|D Chain D, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826499|pdb|1I48|E Chain E, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826500|pdb|1I48|F Chain F, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826501|pdb|1I48|G Chain G, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826502|pdb|1I48|H Chain H, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826503|pdb|1I48|I Chain I, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826504|pdb|1I48|J Chain J, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826505|pdb|1I48|K Chain K, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826506|pdb|1I48|L Chain L, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|4322948|gb|AAD16143.1| cystathionine gamma-synthase precursor [Nicotiana tabacum] Length = 445 Score = 158 bits (399), Expect = 7e-37 Identities = 78/88 (88%), Positives = 82/88 (93%) Frame = +1 Query: 319 FCRSDGSIAIHAGERLGRGIVTDAITTPIVNTSAYFFKKTSELIDFKEGRYSSFEYGRYG 498 F SDGS+AIHAGERLGRGIVTDAITTP+VNTSAYFF KTSELIDFKE R +SFEYGRYG Sbjct: 53 FLNSDGSVAIHAGERLGRGIVTDAITTPVVNTSAYFFNKTSELIDFKEKRRASFEYGRYG 112 Query: 499 NPTTVVAEQKISALEGAESTLLMASGMC 582 NPTTVV E+KISALEGAESTLLMASGMC Sbjct: 113 NPTTVVLEEKISALEGAESTLLMASGMC 140 >gb|AAC19395.1| cystathionine gamma-synthase [Mesembryanthemum crystallinum] Length = 548 Score = 156 bits (395), Expect = 2e-36 Identities = 75/88 (85%), Positives = 83/88 (94%) Frame = +1 Query: 319 FCRSDGSIAIHAGERLGRGIVTDAITTPIVNTSAYFFKKTSELIDFKEGRYSSFEYGRYG 498 F SDGS+AIHAGERLGRGIVTDAITTP+VNTSAYFFKKT++LIDFKEGR +SFEYGRYG Sbjct: 156 FLSSDGSVAIHAGERLGRGIVTDAITTPVVNTSAYFFKKTADLIDFKEGRQTSFEYGRYG 215 Query: 499 NPTTVVAEQKISALEGAESTLLMASGMC 582 NPT+VV E KISALEGAEST+L+ASGMC Sbjct: 216 NPTSVVLEDKISALEGAESTILLASGMC 243 Score = 72.4 bits (176), Expect = 5e-11 Identities = 34/57 (59%), Positives = 41/57 (71%) Frame = +2 Query: 5 GVSFKGALSSLIYKFPPNYARQLRTKSRRNCSNIGVSQVVAATWSTNASESAPPVAG 175 G F + SSLI +FPPN+ RQL TK+RRNCSNIGV+QVVAA+WS N+ A G Sbjct: 46 GRLFSSSSSSLILRFPPNFVRQLSTKARRNCSNIGVAQVVAASWSNNSDAGATSCGG 102 >emb|CAA04772.2| cystathionine gamma synthase [Fragaria vesca] gi|6012969|emb|CAB57356.1| cystathionine gamma synthase [Fragaria vesca] Length = 545 Score = 155 bits (393), Expect = 4e-36 Identities = 76/88 (86%), Positives = 83/88 (94%) Frame = +1 Query: 319 FCRSDGSIAIHAGERLGRGIVTDAITTPIVNTSAYFFKKTSELIDFKEGRYSSFEYGRYG 498 F SDGSIAIHAGERLGRGIVTDAITTP+VNTSAYFFKKT++L+DFKE R +SFEYGRYG Sbjct: 153 FLSSDGSIAIHAGERLGRGIVTDAITTPVVNTSAYFFKKTADLLDFKEKRATSFEYGRYG 212 Query: 499 NPTTVVAEQKISALEGAESTLLMASGMC 582 NPTTVV E+KISALEGAESTLL+ASGMC Sbjct: 213 NPTTVVLEEKISALEGAESTLLLASGMC 240 Score = 72.4 bits (176), Expect = 5e-11 Identities = 34/54 (62%), Positives = 42/54 (77%) Frame = +2 Query: 26 LSSLIYKFPPNYARQLRTKSRRNCSNIGVSQVVAATWSTNASESAPPVAGDAVD 187 LSSLI +FPPN+ RQL TK+RRNCSNIGV+Q+VAA+WS S+ + A AVD Sbjct: 53 LSSLILRFPPNFVRQLSTKARRNCSNIGVAQIVAASWSNKDSDLSAVPAASAVD 106 >gb|AAF74982.1|AF082892_1 cystathionine gamma-synthase isoform 2 [Solanum tuberosum] Length = 540 Score = 155 bits (392), Expect = 5e-36 Identities = 75/88 (85%), Positives = 84/88 (95%) Frame = +1 Query: 319 FCRSDGSIAIHAGERLGRGIVTDAITTPIVNTSAYFFKKTSELIDFKEGRYSSFEYGRYG 498 F SDGSIAIHAGERLGRGIVTDAITTP+VNTSAYFFKKTS+LIDFKE + +SFEYGRYG Sbjct: 148 FLSSDGSIAIHAGERLGRGIVTDAITTPVVNTSAYFFKKTSDLIDFKEKKRASFEYGRYG 207 Query: 499 NPTTVVAEQKISALEGAESTLLMASGMC 582 NPT++VAE+KISALEGA++TLLMASGMC Sbjct: 208 NPTSIVAEEKISALEGADATLLMASGMC 235 Score = 68.2 bits (165), Expect = 1e-09 Identities = 35/60 (58%), Positives = 44/60 (73%), Gaps = 3/60 (5%) Frame = +2 Query: 26 LSSLIYKFPPNYARQLRTKSRRNCSNIGVSQVVAATWSTN-ASESAPPVAG--DAVDLSP 196 +SSLI +FPPN+ RQL K+RRNCSNIG++QVVAA+WS N AS P A DA ++P Sbjct: 53 MSSLILRFPPNFVRQLSVKARRNCSNIGLAQVVAASWSNNHASPDFTPAAKAVDAASIAP 112