BLASTX nr result
ID: Cnidium21_contig00014482
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00014482 (425 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523736.1| conserved hypothetical protein [Ricinus comm... 71 1e-10 ref|XP_002872022.1| hypothetical protein ARALYDRAFT_489143 [Arab... 68 7e-10 ref|NP_568425.1| uncharacterized protein [Arabidopsis thaliana] ... 68 7e-10 ref|XP_004145769.1| PREDICTED: uncharacterized protein LOC101222... 67 1e-09 ref|XP_003606323.1| hypothetical protein MTR_4g057190 [Medicago ... 66 3e-09 >ref|XP_002523736.1| conserved hypothetical protein [Ricinus communis] gi|223537040|gb|EEF38676.1| conserved hypothetical protein [Ricinus communis] Length = 70 Score = 70.9 bits (172), Expect = 1e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 1 SKPLPPQATFRGPYINTGSRDVGPDHQTYSKK 96 SKPLPPQATFRGPYINTGSRD+GPDHQ+YSKK Sbjct: 39 SKPLPPQATFRGPYINTGSRDIGPDHQSYSKK 70 >ref|XP_002872022.1| hypothetical protein ARALYDRAFT_489143 [Arabidopsis lyrata subsp. lyrata] gi|297317859|gb|EFH48281.1| hypothetical protein ARALYDRAFT_489143 [Arabidopsis lyrata subsp. lyrata] Length = 69 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 1 SKPLPPQATFRGPYINTGSRDVGPDHQTYSKK 96 +KPLPPQATFRGPYINTGSRDVGPDH+TY KK Sbjct: 38 TKPLPPQATFRGPYINTGSRDVGPDHRTYPKK 69 >ref|NP_568425.1| uncharacterized protein [Arabidopsis thaliana] gi|79328391|ref|NP_001031924.1| uncharacterized protein [Arabidopsis thaliana] gi|21592531|gb|AAM64480.1| unknown [Arabidopsis thaliana] gi|106879143|gb|ABF82601.1| At5g22875 [Arabidopsis thaliana] gi|332005708|gb|AED93091.1| uncharacterized protein [Arabidopsis thaliana] gi|332005709|gb|AED93092.1| uncharacterized protein [Arabidopsis thaliana] Length = 69 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 1 SKPLPPQATFRGPYINTGSRDVGPDHQTYSKK 96 +KPLPPQATFRGPYINTGSRDVGPDH+TY KK Sbjct: 38 TKPLPPQATFRGPYINTGSRDVGPDHRTYPKK 69 >ref|XP_004145769.1| PREDICTED: uncharacterized protein LOC101222012 [Cucumis sativus] gi|449496209|ref|XP_004160073.1| PREDICTED: uncharacterized LOC101222012 [Cucumis sativus] Length = 69 Score = 67.4 bits (163), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 1 SKPLPPQATFRGPYINTGSRDVGPDHQTYSKK 96 +KPL PQATFRGPYINTGSRDVGPDHQTY+KK Sbjct: 38 TKPLSPQATFRGPYINTGSRDVGPDHQTYTKK 69 >ref|XP_003606323.1| hypothetical protein MTR_4g057190 [Medicago truncatula] gi|355507378|gb|AES88520.1| hypothetical protein MTR_4g057190 [Medicago truncatula] Length = 204 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 1 SKPLPPQATFRGPYINTGSRDVGPDHQTYSKK*F 102 +KPL PQATFRGPYINTGSRD+GPDH+TY KK F Sbjct: 38 TKPLSPQATFRGPYINTGSRDIGPDHETYKKKSF 71