BLASTX nr result
ID: Cnidium21_contig00014390
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00014390 (306 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273532.2| PREDICTED: copper methylamine oxidase-like [... 69 4e-10 emb|CAN62304.1| hypothetical protein VITISV_023689 [Vitis vinifera] 69 4e-10 gb|ACW82416.1| putative copper amine oxidase, partial [Olea euro... 69 5e-10 ref|XP_004155025.1| PREDICTED: copper methylamine oxidase-like [... 68 7e-10 ref|XP_004138093.1| PREDICTED: copper methylamine oxidase-like [... 68 7e-10 >ref|XP_002273532.2| PREDICTED: copper methylamine oxidase-like [Vitis vinifera] gi|296083412|emb|CBI23365.3| unnamed protein product [Vitis vinifera] Length = 774 Score = 68.9 bits (167), Expect = 4e-10 Identities = 33/53 (62%), Positives = 37/53 (69%) Frame = +2 Query: 14 GRRTIAHTLSFVEMVVPYGDPNDPHYRKKALMQGKMALEKILTHLKSGAPRIG 172 GRR++AH LSFVEMVVPYGDPNDPHYRK A G+ L K LK G +G Sbjct: 383 GRRSVAHRLSFVEMVVPYGDPNDPHYRKNAFDAGEDGLGKNAHSLKKGCDCLG 435 >emb|CAN62304.1| hypothetical protein VITISV_023689 [Vitis vinifera] Length = 706 Score = 68.9 bits (167), Expect = 4e-10 Identities = 33/53 (62%), Positives = 37/53 (69%) Frame = +2 Query: 14 GRRTIAHTLSFVEMVVPYGDPNDPHYRKKALMQGKMALEKILTHLKSGAPRIG 172 GRR++AH LSFVEMVVPYGDPNDPHYRK A G+ L K LK G +G Sbjct: 309 GRRSVAHRLSFVEMVVPYGDPNDPHYRKNAFDAGEDGLGKNAHSLKKGCDCLG 361 >gb|ACW82416.1| putative copper amine oxidase, partial [Olea europaea] Length = 529 Score = 68.6 bits (166), Expect = 5e-10 Identities = 34/53 (64%), Positives = 36/53 (67%) Frame = +2 Query: 14 GRRTIAHTLSFVEMVVPYGDPNDPHYRKKALMQGKMALEKILTHLKSGAPRIG 172 GRR IAH LSFVEMVVPYGDPNDPHYRK A G+ L K LK G +G Sbjct: 389 GRRPIAHRLSFVEMVVPYGDPNDPHYRKNAFDAGEDGLGKNAHSLKKGCDCLG 441 >ref|XP_004155025.1| PREDICTED: copper methylamine oxidase-like [Cucumis sativus] Length = 791 Score = 68.2 bits (165), Expect = 7e-10 Identities = 33/53 (62%), Positives = 36/53 (67%) Frame = +2 Query: 14 GRRTIAHTLSFVEMVVPYGDPNDPHYRKKALMQGKMALEKILTHLKSGAPRIG 172 GRR +AH LSFVEMVVPYGDPNDPHYRK A G+ L K LK G +G Sbjct: 396 GRRPVAHRLSFVEMVVPYGDPNDPHYRKNAFDAGEDGLGKNAHSLKKGCDCLG 448 >ref|XP_004138093.1| PREDICTED: copper methylamine oxidase-like [Cucumis sativus] Length = 794 Score = 68.2 bits (165), Expect = 7e-10 Identities = 33/53 (62%), Positives = 36/53 (67%) Frame = +2 Query: 14 GRRTIAHTLSFVEMVVPYGDPNDPHYRKKALMQGKMALEKILTHLKSGAPRIG 172 GRR +AH LSFVEMVVPYGDPNDPHYRK A G+ L K LK G +G Sbjct: 396 GRRPVAHRLSFVEMVVPYGDPNDPHYRKNAFDAGEDGLGKNAHSLKKGCDCLG 448