BLASTX nr result
ID: Cnidium21_contig00014291
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00014291 (744 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001234176.1| PI-phospholipase C PLC5 [Solanum lycopersicu... 74 4e-11 gb|AAW22879.1| putative phospholipase C [Solanum lycopersicum] 73 7e-11 emb|CAC13988.1| phosphoinositide-specific phospholipase C [Digit... 66 7e-09 ref|XP_002271986.2| PREDICTED: phosphoinositide phospholipase C ... 65 1e-08 ref|XP_003558160.1| PREDICTED: phosphoinositide phospholipase C ... 65 1e-08 >ref|NP_001234176.1| PI-phospholipase C PLC5 [Solanum lycopersicum] gi|158827644|gb|ABW80999.1| PI-phospholipase C PLC5 [Solanum lycopersicum] Length = 584 Score = 73.6 bits (179), Expect = 4e-11 Identities = 31/45 (68%), Positives = 40/45 (88%) Frame = -1 Query: 396 QMVIEIFGELLYYPEPGCFDVFPSPQALKHQIVLSTKPPKEYLDS 262 +MVI+IFGE+LYYP+ C D FPSP+ LK++I+LSTKPPKEYL+S Sbjct: 211 EMVIQIFGEMLYYPQSECLDEFPSPEELKNRIILSTKPPKEYLES 255 >gb|AAW22879.1| putative phospholipase C [Solanum lycopersicum] Length = 574 Score = 72.8 bits (177), Expect = 7e-11 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -1 Query: 393 MVIEIFGELLYYPEPGCFDVFPSPQALKHQIVLSTKPPKEYLDS 262 MVI+IFGE+LYYP+ C D FPSP+ LK++I+LSTKPPKEYL+S Sbjct: 201 MVIQIFGEMLYYPQSECLDEFPSPEELKNRIILSTKPPKEYLES 244 >emb|CAC13988.1| phosphoinositide-specific phospholipase C [Digitaria sanguinalis] Length = 630 Score = 66.2 bits (160), Expect = 7e-09 Identities = 28/45 (62%), Positives = 38/45 (84%) Frame = -1 Query: 396 QMVIEIFGELLYYPEPGCFDVFPSPQALKHQIVLSTKPPKEYLDS 262 QMV+E+FG++LYYPE FPSP+ALK +++LSTKPPKEYL++ Sbjct: 254 QMVLEVFGDMLYYPESKHLQEFPSPEALKGRVMLSTKPPKEYLEA 298 >ref|XP_002271986.2| PREDICTED: phosphoinositide phospholipase C 6 [Vitis vinifera] Length = 591 Score = 65.5 bits (158), Expect = 1e-08 Identities = 25/45 (55%), Positives = 39/45 (86%) Frame = -1 Query: 396 QMVIEIFGELLYYPEPGCFDVFPSPQALKHQIVLSTKPPKEYLDS 262 +MV + FG++LYYPE GC + FPSP++LK++I++STKPPKE +++ Sbjct: 221 EMVTQTFGDMLYYPESGCLEEFPSPESLKYKIIISTKPPKEDVEA 265 >ref|XP_003558160.1| PREDICTED: phosphoinositide phospholipase C 4-like isoform 2 [Brachypodium distachyon] Length = 560 Score = 65.5 bits (158), Expect = 1e-08 Identities = 27/45 (60%), Positives = 38/45 (84%) Frame = -1 Query: 396 QMVIEIFGELLYYPEPGCFDVFPSPQALKHQIVLSTKPPKEYLDS 262 +MV+E+FG++LYYPE FPSP+ALK +++LSTKPPKEYL++ Sbjct: 222 KMVLEVFGDILYYPESKHLQEFPSPEALKGRVILSTKPPKEYLEA 266