BLASTX nr result
ID: Cnidium21_contig00014282
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00014282 (436 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520074.1| protein with unknown function [Ricinus commu... 60 2e-07 ref|XP_002325391.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 gb|AAF25968.1|AC017118_5 F6N18.8 [Arabidopsis thaliana] 59 4e-07 ref|NP_973953.1| PLATZ transcription factor domain-containing pr... 59 4e-07 ref|NP_564406.1| PLATZ transcription factor domain-containing pr... 59 4e-07 >ref|XP_002520074.1| protein with unknown function [Ricinus communis] gi|223540838|gb|EEF42398.1| protein with unknown function [Ricinus communis] Length = 251 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 346 IRRSSYHDVIRVSEIQKYLEITGIQTYVIN 435 IRRSSYHDVIRVSEIQKYL+ITG+QTY+IN Sbjct: 103 IRRSSYHDVIRVSEIQKYLDITGVQTYIIN 132 >ref|XP_002325391.1| predicted protein [Populus trichocarpa] gi|222862266|gb|EEE99772.1| predicted protein [Populus trichocarpa] Length = 241 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 346 IRRSSYHDVIRVSEIQKYLEITGIQTYVIN 435 IRRSSYHDVIRVSEIQKYL+ITG+QTY+IN Sbjct: 94 IRRSSYHDVIRVSEIQKYLDITGVQTYIIN 123 >gb|AAF25968.1|AC017118_5 F6N18.8 [Arabidopsis thaliana] Length = 270 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 346 IRRSSYHDVIRVSEIQKYLEITGIQTYVIN 435 IRRSSYHDVIRVSEIQK+L+ITG+QTYVIN Sbjct: 123 IRRSSYHDVIRVSEIQKFLDITGVQTYVIN 152 >ref|NP_973953.1| PLATZ transcription factor domain-containing protein [Arabidopsis thaliana] gi|117958340|gb|ABK59666.1| At1g32700 [Arabidopsis thaliana] gi|332193398|gb|AEE31519.1| PLATZ transcription factor domain-containing protein [Arabidopsis thaliana] Length = 174 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 346 IRRSSYHDVIRVSEIQKYLEITGIQTYVIN 435 IRRSSYHDVIRVSEIQK+L+ITG+QTYVIN Sbjct: 27 IRRSSYHDVIRVSEIQKFLDITGVQTYVIN 56 >ref|NP_564406.1| PLATZ transcription factor domain-containing protein [Arabidopsis thaliana] gi|332193397|gb|AEE31518.1| PLATZ transcription factor domain-containing protein [Arabidopsis thaliana] Length = 213 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 346 IRRSSYHDVIRVSEIQKYLEITGIQTYVIN 435 IRRSSYHDVIRVSEIQK+L+ITG+QTYVIN Sbjct: 66 IRRSSYHDVIRVSEIQKFLDITGVQTYVIN 95