BLASTX nr result
ID: Cnidium21_contig00014249
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00014249 (311 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA71738.1| 1-aminocyclopropane-1-carboxylate oxidase [Betul... 79 3e-13 gb|AEM62885.1| ACC oxidase 6 [Actinidia chinensis] 78 6e-13 ref|XP_002302856.1| 1-aminocyclopropane-1-carboxylate [Populus t... 77 1e-12 gb|ADK39027.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Be... 77 1e-12 gb|AEM62882.1| ACC oxidase 4 [Actinidia deliciosa] 77 2e-12 >emb|CAA71738.1| 1-aminocyclopropane-1-carboxylate oxidase [Betula pendula] Length = 318 Score = 79.3 bits (194), Expect = 3e-13 Identities = 39/45 (86%), Positives = 42/45 (93%), Gaps = 1/45 (2%) Frame = +3 Query: 6 LLEKE-EKGHLYPKFVFQDYMKLYAGLKFQAKEPRFEAMKAMEIT 137 L+EKE EKG +YPKFVF+DYMKLYAGLKFQAKEPRFEAMKAME T Sbjct: 265 LVEKEAEKGQVYPKFVFEDYMKLYAGLKFQAKEPRFEAMKAMEST 309 >gb|AEM62885.1| ACC oxidase 6 [Actinidia chinensis] Length = 317 Score = 78.2 bits (191), Expect = 6e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +3 Query: 6 LLEKEEKGHLYPKFVFQDYMKLYAGLKFQAKEPRFEAMKAME 131 L+EKEE+ +YPKFVF+DYMKLYAGLKFQAKEPRFEAMKAME Sbjct: 265 LVEKEEQKQVYPKFVFEDYMKLYAGLKFQAKEPRFEAMKAME 306 >ref|XP_002302856.1| 1-aminocyclopropane-1-carboxylate [Populus trichocarpa] gi|118488209|gb|ABK95924.1| unknown [Populus trichocarpa] gi|222844582|gb|EEE82129.1| 1-aminocyclopropane-1-carboxylate [Populus trichocarpa] Length = 311 Score = 77.4 bits (189), Expect = 1e-12 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +3 Query: 12 EKEEKGHLYPKFVFQDYMKLYAGLKFQAKEPRFEAMKAME 131 E EEK HLYPKFVF DYMKLYAGLKFQAKEPRFEAMKA+E Sbjct: 269 EAEEKKHLYPKFVFDDYMKLYAGLKFQAKEPRFEAMKAVE 308 >gb|ADK39027.1| 1-aminocyclopropane-1-carboxylic acid oxidase [Betula luminifera] Length = 318 Score = 77.0 bits (188), Expect = 1e-12 Identities = 38/45 (84%), Positives = 41/45 (91%), Gaps = 1/45 (2%) Frame = +3 Query: 6 LLEKE-EKGHLYPKFVFQDYMKLYAGLKFQAKEPRFEAMKAMEIT 137 L+EKE EKG +YPKFVF+DYMKLYAGLKFQAKEPRFEAMKA E T Sbjct: 265 LVEKEAEKGQVYPKFVFEDYMKLYAGLKFQAKEPRFEAMKATEST 309 >gb|AEM62882.1| ACC oxidase 4 [Actinidia deliciosa] Length = 317 Score = 76.6 bits (187), Expect = 2e-12 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = +3 Query: 6 LLEKEEKGHLYPKFVFQDYMKLYAGLKFQAKEPRFEAMKAME 131 L+EKEE+ +YPKFVF+DYMKLYAGLKFQAKEPRF+AMKAME Sbjct: 265 LVEKEEQKQVYPKFVFEDYMKLYAGLKFQAKEPRFKAMKAME 306