BLASTX nr result
ID: Cnidium21_contig00014148
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00014148 (848 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_197550.1| glutaredoxin-C4 [Arabidopsis thaliana] gi|11937... 176 6e-42 ref|XP_002871942.1| hypothetical protein ARALYDRAFT_910087 [Arab... 176 6e-42 gb|AAM61279.1| glutaredoxin [Arabidopsis thaliana] 175 1e-41 emb|CBI17872.3| unnamed protein product [Vitis vinifera] 166 6e-39 ref|XP_002266525.1| PREDICTED: glutaredoxin-C4-like [Vitis vinif... 166 6e-39 >ref|NP_197550.1| glutaredoxin-C4 [Arabidopsis thaliana] gi|119370637|sp|Q8LFQ6.2|GRXC4_ARATH RecName: Full=Glutaredoxin-C4; Short=AtGrxC4 gi|6735386|emb|CAB69043.1| glutaredoxin [Arabidopsis thaliana] gi|25082927|gb|AAN72016.1| glutaredoxin [Arabidopsis thaliana] gi|25082941|gb|AAN72019.1| glutaredoxin [Arabidopsis thaliana] gi|98960865|gb|ABF58916.1| At5g20500 [Arabidopsis thaliana] gi|332005470|gb|AED92853.1| glutaredoxin-C4 [Arabidopsis thaliana] Length = 135 Score = 176 bits (446), Expect = 6e-42 Identities = 83/98 (84%), Positives = 92/98 (93%) Frame = -3 Query: 594 FVKKTISSHSIVIFSKSYCPYCRKAKSVFQELNQKPYVVELDEREDGWEIQGSVGQLVGR 415 FVKKTISSH IVIFSKSYCPYC+KAKSVF+EL+Q PYVVELDEREDGW IQ ++G++VGR Sbjct: 34 FVKKTISSHKIVIFSKSYCPYCKKAKSVFRELDQVPYVVELDEREDGWSIQTALGEIVGR 93 Query: 414 RTVPQVFINGKHIGGSDDTVDAYESGELAKLLGISAAK 301 RTVPQVFINGKH+GGSDDTVDAYESGELAKLLG+S K Sbjct: 94 RTVPQVFINGKHLGGSDDTVDAYESGELAKLLGVSGNK 131 >ref|XP_002871942.1| hypothetical protein ARALYDRAFT_910087 [Arabidopsis lyrata subsp. lyrata] gi|297317779|gb|EFH48201.1| hypothetical protein ARALYDRAFT_910087 [Arabidopsis lyrata subsp. lyrata] Length = 132 Score = 176 bits (446), Expect = 6e-42 Identities = 84/98 (85%), Positives = 92/98 (93%) Frame = -3 Query: 594 FVKKTISSHSIVIFSKSYCPYCRKAKSVFQELNQKPYVVELDEREDGWEIQGSVGQLVGR 415 FVKKTISSH IVIFSKSYCPYCRKAKSVF+EL+Q PYVVELDEREDGW IQ ++G++VGR Sbjct: 31 FVKKTISSHKIVIFSKSYCPYCRKAKSVFRELDQVPYVVELDEREDGWSIQTALGEIVGR 90 Query: 414 RTVPQVFINGKHIGGSDDTVDAYESGELAKLLGISAAK 301 RTVPQVFI+GKHIGGSDDTVDAYESGELAKLLG+S K Sbjct: 91 RTVPQVFIDGKHIGGSDDTVDAYESGELAKLLGVSGNK 128 >gb|AAM61279.1| glutaredoxin [Arabidopsis thaliana] Length = 135 Score = 175 bits (444), Expect = 1e-41 Identities = 83/98 (84%), Positives = 91/98 (92%) Frame = -3 Query: 594 FVKKTISSHSIVIFSKSYCPYCRKAKSVFQELNQKPYVVELDEREDGWEIQGSVGQLVGR 415 FVKKTISSH IVIFSKSYCPYC KAKSVF+EL+Q PYVVELDEREDGW IQ ++G++VGR Sbjct: 34 FVKKTISSHKIVIFSKSYCPYCNKAKSVFRELDQVPYVVELDEREDGWSIQTALGEIVGR 93 Query: 414 RTVPQVFINGKHIGGSDDTVDAYESGELAKLLGISAAK 301 RTVPQVFINGKH+GGSDDTVDAYESGELAKLLG+S K Sbjct: 94 RTVPQVFINGKHLGGSDDTVDAYESGELAKLLGVSGNK 131 >emb|CBI17872.3| unnamed protein product [Vitis vinifera] Length = 136 Score = 166 bits (420), Expect = 6e-39 Identities = 77/100 (77%), Positives = 90/100 (90%) Frame = -3 Query: 594 FVKKTISSHSIVIFSKSYCPYCRKAKSVFQELNQKPYVVELDEREDGWEIQGSVGQLVGR 415 FVKKTISSH I IFSKSYCPYC++AK+VF+ELNQ PYVVELD+REDGW IQ ++ +VGR Sbjct: 35 FVKKTISSHKIAIFSKSYCPYCKRAKAVFKELNQVPYVVELDQREDGWNIQDALSGMVGR 94 Query: 414 RTVPQVFINGKHIGGSDDTVDAYESGELAKLLGISAAKTD 295 RTVPQVFINGKHIGGSDDTV+AY+SG+LAKLLGI+ +D Sbjct: 95 RTVPQVFINGKHIGGSDDTVEAYQSGDLAKLLGIAEEDSD 134 >ref|XP_002266525.1| PREDICTED: glutaredoxin-C4-like [Vitis vinifera] Length = 140 Score = 166 bits (420), Expect = 6e-39 Identities = 77/100 (77%), Positives = 90/100 (90%) Frame = -3 Query: 594 FVKKTISSHSIVIFSKSYCPYCRKAKSVFQELNQKPYVVELDEREDGWEIQGSVGQLVGR 415 FVKKTISSH I IFSKSYCPYC++AK+VF+ELNQ PYVVELD+REDGW IQ ++ +VGR Sbjct: 39 FVKKTISSHKIAIFSKSYCPYCKRAKAVFKELNQVPYVVELDQREDGWNIQDALSGMVGR 98 Query: 414 RTVPQVFINGKHIGGSDDTVDAYESGELAKLLGISAAKTD 295 RTVPQVFINGKHIGGSDDTV+AY+SG+LAKLLGI+ +D Sbjct: 99 RTVPQVFINGKHIGGSDDTVEAYQSGDLAKLLGIAEEDSD 138