BLASTX nr result
ID: Cnidium21_contig00014106
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00014106 (444 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EAZ37469.1| hypothetical protein OsJ_21802 [Oryza sativa Japo... 57 2e-06 >gb|EAZ37469.1| hypothetical protein OsJ_21802 [Oryza sativa Japonica Group] Length = 966 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/67 (40%), Positives = 42/67 (62%) Frame = +3 Query: 6 VMDIVDPRIVLDQEKHGMTVNQLYSRAAMEVCLTSIFEVGILCSEETPRKRIDISVAIKK 185 V D+VD ++L +E M N L ++ A C+TSI VGILCS++ P +R+ I A+ + Sbjct: 897 VEDVVDQNLILPREDTEMDHNTLLNKEAALACITSILRVGILCSKQLPTERVQIRDAVIE 956 Query: 186 LHVARDK 206 LH ++K Sbjct: 957 LHKIKEK 963