BLASTX nr result
ID: Cnidium21_contig00014083
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00014083 (444 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADB85373.1| putative transposon protein [Phyllostachys edulis] 55 5e-06 >gb|ADB85373.1| putative transposon protein [Phyllostachys edulis] Length = 1414 Score = 55.5 bits (132), Expect = 5e-06 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 2/82 (2%) Frame = -2 Query: 422 MIHNIPIAPHNVKISIDDVVAEYQLTPLPVPC-DEHETVGNAVGSFVQWPK-DLVMLGQN 249 ++H +AP K+++D V A +++ PL +P DE T+G AVG+F+QWPK D+ + Sbjct: 1044 LVHGANLAPGFAKVNVDGVCANFEVVPLKIPPNDEVMTLGQAVGTFIQWPKEDICLELPA 1103 Query: 248 PISLEKKKGLEMSPKRIFQIPK 183 P+S ++ S R PK Sbjct: 1104 PVSTSRECPTTASSPRDLTAPK 1125