BLASTX nr result
ID: Cnidium21_contig00013989
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00013989 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531985.1| Ubiquitin ligase protein FANCL, putative [Ri... 56 3e-06 >ref|XP_002531985.1| Ubiquitin ligase protein FANCL, putative [Ricinus communis] gi|223528344|gb|EEF30384.1| Ubiquitin ligase protein FANCL, putative [Ricinus communis] Length = 309 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/42 (59%), Positives = 30/42 (71%) Frame = +1 Query: 106 MKDKPVRENITNIFELKLPGPPSVHIDDQQTECEICYAQYLP 231 M+DK EN+ +I E +LP PP V +DQQ EC ICYAQYLP Sbjct: 152 MQDKTFLENLLSILETELPKPPDVQKNDQQIECGICYAQYLP 193