BLASTX nr result
ID: Cnidium21_contig00013957
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00013957 (517 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510986.1| conserved hypothetical protein [Ricinus comm... 60 1e-07 emb|CAN69656.1| hypothetical protein VITISV_013005 [Vitis vinifera] 56 3e-06 >ref|XP_002510986.1| conserved hypothetical protein [Ricinus communis] gi|223550101|gb|EEF51588.1| conserved hypothetical protein [Ricinus communis] Length = 852 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/54 (53%), Positives = 37/54 (68%) Frame = +1 Query: 124 TGEKTSTVEKSTELQKLKTGFRICKPQGTFLWPKMGANDGSSPVAVQVEDLFMV 285 T T +K+ ++++LK+GFRICKPQGTFLWP G + S V VQ EDLF V Sbjct: 558 TKSAAPTEDKAAKIERLKSGFRICKPQGTFLWPNKGIS--SPQVVVQFEDLFSV 609 >emb|CAN69656.1| hypothetical protein VITISV_013005 [Vitis vinifera] Length = 766 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +1 Query: 148 EKSTELQKLKTGFRICKPQGTFLWPKMGANDGSSPVAVQVEDL 276 EK+ ++Q+LK+GFR+CKPQGTFLWP A S V VQVEDL Sbjct: 558 EKAAKIQRLKSGFRLCKPQGTFLWPSSMA--VSPQVVVQVEDL 598