BLASTX nr result
ID: Cnidium21_contig00013935
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00013935 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004155227.1| PREDICTED: LOW QUALITY PROTEIN: elongation f... 73 3e-11 ref|XP_004133719.1| PREDICTED: elongation factor 1-gamma-like [C... 73 3e-11 gb|AAK59587.1| putative elongation factor 1B gamma [Arabidopsis ... 72 4e-11 ref|NP_176084.1| elongation factor EF-1 gamma subunit [Arabidops... 72 4e-11 ref|NP_563848.1| elongation factor EF-1 gamma subunit [Arabidops... 72 4e-11 >ref|XP_004155227.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-gamma-like [Cucumis sativus] Length = 409 Score = 72.8 bits (177), Expect = 3e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 4 KVDISDEAQKERVSQMIEDQEPFEGEALLDAKCFK 108 KVDISDEAQKERVSQMIEDQEPFEGEALLDAKCFK Sbjct: 375 KVDISDEAQKERVSQMIEDQEPFEGEALLDAKCFK 409 >ref|XP_004133719.1| PREDICTED: elongation factor 1-gamma-like [Cucumis sativus] Length = 409 Score = 72.8 bits (177), Expect = 3e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 4 KVDISDEAQKERVSQMIEDQEPFEGEALLDAKCFK 108 KVDISDEAQKERVSQMIEDQEPFEGEALLDAKCFK Sbjct: 375 KVDISDEAQKERVSQMIEDQEPFEGEALLDAKCFK 409 >gb|AAK59587.1| putative elongation factor 1B gamma [Arabidopsis thaliana] Length = 413 Score = 72.4 bits (176), Expect = 4e-11 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 1 TKVDISDEAQKERVSQMIEDQEPFEGEALLDAKCFK 108 TKVDISDEAQKERVSQMIED EPFEGEALLDAKCFK Sbjct: 378 TKVDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK 413 >ref|NP_176084.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana] gi|79320145|ref|NP_001031202.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana] gi|13626393|sp|Q9FVT2.1|EF1G2_ARATH RecName: Full=Probable elongation factor 1-gamma 2; Short=EF-1-gamma 2; AltName: Full=eEF-1B gamma 2 gi|12321359|gb|AAG50755.1|AC079733_23 elongation factor 1B gamma, putative [Arabidopsis thaliana] gi|13877603|gb|AAK43879.1|AF370502_1 Unknown protein [Arabidopsis thaliana] gi|15983511|gb|AAL11623.1|AF424630_1 At1g57720/T8L23_18 [Arabidopsis thaliana] gi|16226841|gb|AAL16277.1|AF428347_1 At1g57720/T8L23_18 [Arabidopsis thaliana] gi|17978699|gb|AAL47343.1| unknown protein [Arabidopsis thaliana] gi|21360471|gb|AAM47351.1| At1g57720/T8L23_18 [Arabidopsis thaliana] gi|21553395|gb|AAM62488.1| elongation factor 1B gamma, putative [Arabidopsis thaliana] gi|24030437|gb|AAN41373.1| putative elongation factor 1B gamma [Arabidopsis thaliana] gi|332195334|gb|AEE33455.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana] gi|332195335|gb|AEE33456.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana] Length = 413 Score = 72.4 bits (176), Expect = 4e-11 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 1 TKVDISDEAQKERVSQMIEDQEPFEGEALLDAKCFK 108 TKVDISDEAQKERVSQMIED EPFEGEALLDAKCFK Sbjct: 378 TKVDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK 413 >ref|NP_563848.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana] gi|13626364|sp|O04487.1|EF1G1_ARATH RecName: Full=Probable elongation factor 1-gamma 1; Short=EF-1-gamma 1; AltName: Full=eEF-1B gamma 1 gi|2160158|gb|AAB60721.1| Similar to elongation factor 1-gamma (gb|EF1G_XENLA). ESTs gb|T20564,gb|T45940,gb|T04527 come from this gene [Arabidopsis thaliana] gi|222424502|dbj|BAH20206.1| AT1G09640 [Arabidopsis thaliana] gi|332190351|gb|AEE28472.1| elongation factor EF-1 gamma subunit [Arabidopsis thaliana] Length = 414 Score = 72.4 bits (176), Expect = 4e-11 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 1 TKVDISDEAQKERVSQMIEDQEPFEGEALLDAKCFK 108 TKVDISDEAQKERVSQMIED EPFEGEALLDAKCFK Sbjct: 379 TKVDISDEAQKERVSQMIEDAEPFEGEALLDAKCFK 414