BLASTX nr result
ID: Cnidium21_contig00013870
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00013870 (307 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEY80378.1| farnesyl diphosphate synthase [Santalum album] 61 8e-08 gb|ACS74708.1| farnesyl pyrophosphate synthase [Magnolia chapensis] 61 1e-07 gb|ACJ38671.1| farnesyl pyrophosphate synthase [Chimonanthus pra... 60 1e-07 gb|ABY90139.1| farnesyl diphosphate synthase [Bupleurum chinense] 60 1e-07 gb|AAV58896.1| farnesyl diphosphate synthase [Centella asiatica] 60 1e-07 >gb|AEY80378.1| farnesyl diphosphate synthase [Santalum album] Length = 342 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = +3 Query: 126 LQAYFLVLDDIMDGSHTRGGQPCWFRVYNI*FRILTPSLQLR 251 LQAYFLVLDDIMDGSHTR GQPCWFR+ + + + LR Sbjct: 85 LQAYFLVLDDIMDGSHTRRGQPCWFRLPEVGLNAVNDGIMLR 126 >gb|ACS74708.1| farnesyl pyrophosphate synthase [Magnolia chapensis] Length = 351 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = +3 Query: 126 LQAYFLVLDDIMDGSHTRGGQPCWFRVYNI*FRILTPSLQLR 251 LQAYFLVLDDIMDGSHTR GQPCWFRV + + + LR Sbjct: 94 LQAYFLVLDDIMDGSHTRRGQPCWFRVPKVDMIAINDGILLR 135 >gb|ACJ38671.1| farnesyl pyrophosphate synthase [Chimonanthus praecox] Length = 358 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = +3 Query: 126 LQAYFLVLDDIMDGSHTRGGQPCWFRVYNI*FRILTPSLQLR 251 LQAYFLVLDDIMDGSHTR GQPCWFRV + + + LR Sbjct: 101 LQAYFLVLDDIMDGSHTRRGQPCWFRVPKVDMIAVNDGILLR 142 >gb|ABY90139.1| farnesyl diphosphate synthase [Bupleurum chinense] Length = 155 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = +3 Query: 126 LQAYFLVLDDIMDGSHTRGGQPCWFRVYNI*FRILTPSLQLR 251 LQAYFLVLDDIMDGSHTR GQPCWFRV + + + LR Sbjct: 8 LQAYFLVLDDIMDGSHTRRGQPCWFRVPKVGMIAVNDGILLR 49 >gb|AAV58896.1| farnesyl diphosphate synthase [Centella asiatica] Length = 342 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = +3 Query: 126 LQAYFLVLDDIMDGSHTRGGQPCWFRVYNI*FRILTPSLQLR 251 LQAYFLVLDDIMDGSHTR GQPCWFR+ + + + LR Sbjct: 85 LQAYFLVLDDIMDGSHTRRGQPCWFRIPKVGMIAINDGILLR 126