BLASTX nr result
ID: Cnidium21_contig00013436
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00013436 (559 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71712.1| hypothetical protein VITISV_013459 [Vitis vinifera] 79 4e-13 >emb|CAN71712.1| hypothetical protein VITISV_013459 [Vitis vinifera] Length = 115 Score = 79.3 bits (194), Expect = 4e-13 Identities = 45/110 (40%), Positives = 64/110 (58%), Gaps = 8/110 (7%) Frame = -3 Query: 470 LSEENVKDYVNKKLEEVLILMQY-------RWDKVFPKPQETRADKFIRWFKVSTPFMIT 312 + E+V +V +KL+E+L+L++ DKVF ++R +K W +V PF+I Sbjct: 1 MGAESVMKFVVEKLKELLVLLENFGGYLVDEVDKVFAP--DSRGEKLRHWIQVGAPFLIL 58 Query: 311 GLVILMLI-CCWRCCSGRRSVRMMKAPGRNSGMPRDVPLMRNPGSYFHNL 165 GLV+++ CC CC GRR V+MMKAPGR+ M R P NP YF L Sbjct: 59 GLVLVVFYYCCCGCCRGRRGVKMMKAPGRDYRMARP-PFESNPRGYFRGL 107