BLASTX nr result
ID: Cnidium21_contig00013182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00013182 (914 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003624192.1| Thioredoxin [Medicago truncatula] gi|3554992... 176 9e-42 gb|ACJ83989.1| unknown [Medicago truncatula] gi|388514077|gb|AFK... 176 9e-42 ref|XP_002325907.1| thioredoxin f [Populus trichocarpa] gi|11848... 175 1e-41 gb|ADQ53451.1| plastid thioredoxin F precursor [Nicotiana tabacum] 174 3e-41 ref|NP_197144.1| thioredoxin F2 [Arabidopsis thaliana] gi|111354... 172 1e-40 >ref|XP_003624192.1| Thioredoxin [Medicago truncatula] gi|355499207|gb|AES80410.1| Thioredoxin [Medicago truncatula] Length = 182 Score = 176 bits (445), Expect = 9e-42 Identities = 82/102 (80%), Positives = 92/102 (90%) Frame = +1 Query: 325 DKDTFWPLVNAAADKIVVLDMYTQWCGPCKIIAPKFKELAQKYSDVVFLKLDCNQDNKAL 504 +KDTFWP+VNAA DK VVLDMYTQWCGPCK+IAPK+KELA+KY DVVFLKLDCNQDNK L Sbjct: 81 NKDTFWPIVNAAGDKTVVLDMYTQWCGPCKVIAPKYKELAEKYLDVVFLKLDCNQDNKPL 140 Query: 505 AKELGIKVVPTFKIIKDGKVVNEVTGAKLDRIVSAIEDVRST 630 AKELGIKVVPTFKI+KD K+V EVTGAK D +V AI+ VRS+ Sbjct: 141 AKELGIKVVPTFKILKDSKIVKEVTGAKYDDLVFAIDTVRSS 182 >gb|ACJ83989.1| unknown [Medicago truncatula] gi|388514077|gb|AFK45100.1| unknown [Medicago truncatula] Length = 186 Score = 176 bits (445), Expect = 9e-42 Identities = 82/102 (80%), Positives = 92/102 (90%) Frame = +1 Query: 325 DKDTFWPLVNAAADKIVVLDMYTQWCGPCKIIAPKFKELAQKYSDVVFLKLDCNQDNKAL 504 +KDTFWP+VNAA DK VVLDMYTQWCGPCK+IAPK+KELA+KY DVVFLKLDCNQDNK L Sbjct: 85 NKDTFWPIVNAAGDKTVVLDMYTQWCGPCKVIAPKYKELAEKYLDVVFLKLDCNQDNKPL 144 Query: 505 AKELGIKVVPTFKIIKDGKVVNEVTGAKLDRIVSAIEDVRST 630 AKELGIKVVPTFKI+KD K+V EVTGAK D +V AI+ VRS+ Sbjct: 145 AKELGIKVVPTFKILKDSKIVKEVTGAKYDDLVFAIDTVRSS 186 >ref|XP_002325907.1| thioredoxin f [Populus trichocarpa] gi|118488397|gb|ABK96015.1| unknown [Populus trichocarpa] gi|222862782|gb|EEF00289.1| thioredoxin f [Populus trichocarpa] Length = 188 Score = 175 bits (444), Expect = 1e-41 Identities = 81/100 (81%), Positives = 90/100 (90%) Frame = +1 Query: 328 KDTFWPLVNAAADKIVVLDMYTQWCGPCKIIAPKFKELAQKYSDVVFLKLDCNQDNKALA 507 KDTFWP+VN+A DK VVLDMYTQWCGPCK+IAPK+KEL+QKY DVVFLKLDCNQ+NK LA Sbjct: 87 KDTFWPIVNSAGDKTVVLDMYTQWCGPCKLIAPKYKELSQKYDDVVFLKLDCNQENKPLA 146 Query: 508 KELGIKVVPTFKIIKDGKVVNEVTGAKLDRIVSAIEDVRS 627 KELGIKVVPTFKI+K GK+V EVTGAK D +V AIE VRS Sbjct: 147 KELGIKVVPTFKILKQGKIVKEVTGAKFDNLVIAIESVRS 186 >gb|ADQ53451.1| plastid thioredoxin F precursor [Nicotiana tabacum] Length = 175 Score = 174 bits (440), Expect = 3e-41 Identities = 79/101 (78%), Positives = 93/101 (92%) Frame = +1 Query: 328 KDTFWPLVNAAADKIVVLDMYTQWCGPCKIIAPKFKELAQKYSDVVFLKLDCNQDNKALA 507 KDTFWP+V AA DK VV+DMYTQWCGPCK+IAPKF+EL++ Y+DVVFLKLDCNQDN+ LA Sbjct: 75 KDTFWPIVEAAGDKTVVVDMYTQWCGPCKVIAPKFQELSKNYNDVVFLKLDCNQDNRPLA 134 Query: 508 KELGIKVVPTFKIIKDGKVVNEVTGAKLDRIVSAIEDVRST 630 KELGIKVVPTFKI+K+ KVV EVTGAKLD +++AIEDVRS+ Sbjct: 135 KELGIKVVPTFKILKNNKVVKEVTGAKLDNLIAAIEDVRSS 175 >ref|NP_197144.1| thioredoxin F2 [Arabidopsis thaliana] gi|11135405|sp|Q9XFH9.1|TRXF2_ARATH RecName: Full=Thioredoxin F2, chloroplastic; Short=AtTrxf2; AltName: Full=Thioredoxin F1; Short=AtTrxf1; Flags: Precursor gi|4973254|gb|AAD35004.1|AF144386_1 thioredoxin f2 [Arabidopsis thaliana] gi|13878187|gb|AAK44171.1|AF370356_1 putative thioredoxin f2 protein [Arabidopsis thaliana] gi|9759122|dbj|BAB09607.1| thioredoxin f2 [Arabidopsis thaliana] gi|16323396|gb|AAL15192.1| putative thioredoxin f2 protein [Arabidopsis thaliana] gi|332004905|gb|AED92288.1| thioredoxin F2 [Arabidopsis thaliana] Length = 185 Score = 172 bits (436), Expect = 1e-40 Identities = 79/101 (78%), Positives = 91/101 (90%) Frame = +1 Query: 325 DKDTFWPLVNAAADKIVVLDMYTQWCGPCKIIAPKFKELAQKYSDVVFLKLDCNQDNKAL 504 DKDTFWP+V AA DKIVVLDMYTQWCGPCK+IAPK+KEL++KY D+VFLKLDCNQDNK L Sbjct: 84 DKDTFWPIVKAAGDKIVVLDMYTQWCGPCKVIAPKYKELSEKYQDMVFLKLDCNQDNKPL 143 Query: 505 AKELGIKVVPTFKIIKDGKVVNEVTGAKLDRIVSAIEDVRS 627 AKELGI+VVPTFKI+KD KVV EVTGAK + +++AIE RS Sbjct: 144 AKELGIRVVPTFKILKDNKVVKEVTGAKYEDLLAAIEAARS 184