BLASTX nr result
ID: Cnidium21_contig00013003
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00013003 (1709 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002876234.1| hypothetical protein ARALYDRAFT_485789 [Arab... 74 2e-10 ref|NP_974426.1| proteasome inhibitor subunit 1 (PI31) [Arabidop... 72 5e-10 ref|NP_190965.1| proteasome inhibitor subunit 1 (PI31) [Arabidop... 72 5e-10 ref|XP_003632664.1| PREDICTED: probable proteasome inhibitor iso... 69 5e-09 ref|XP_002275006.1| PREDICTED: probable proteasome inhibitor iso... 69 5e-09 >ref|XP_002876234.1| hypothetical protein ARALYDRAFT_485789 [Arabidopsis lyrata subsp. lyrata] gi|297322072|gb|EFH52493.1| hypothetical protein ARALYDRAFT_485789 [Arabidopsis lyrata subsp. lyrata] Length = 302 Score = 73.6 bits (179), Expect = 2e-10 Identities = 36/57 (63%), Positives = 42/57 (73%), Gaps = 6/57 (10%) Frame = +2 Query: 2 VGIDGWDQFDDNYAFVYL------KKILVKCLAMNDTLLVDVLKNGGEEPLHLEINV 154 VGI+GW++FD YAFVY KKILVKCLAM+D LLVD + +GG EP HLEI V Sbjct: 61 VGIEGWNEFDGEYAFVYANPKKGSKKILVKCLAMDDKLLVDAIADGGAEPAHLEIKV 117 >ref|NP_974426.1| proteasome inhibitor subunit 1 (PI31) [Arabidopsis thaliana] gi|332645644|gb|AEE79165.1| proteasome inhibitor subunit 1 (PI31) [Arabidopsis thaliana] Length = 252 Score = 72.0 bits (175), Expect = 5e-10 Identities = 35/57 (61%), Positives = 42/57 (73%), Gaps = 6/57 (10%) Frame = +2 Query: 2 VGIDGWDQFDDNYAFVYL------KKILVKCLAMNDTLLVDVLKNGGEEPLHLEINV 154 VGI+GW++F+ YAFVY KKILVKCLAM+D LLVD + +GG EP HLEI V Sbjct: 61 VGIEGWNEFEGEYAFVYANPKKGSKKILVKCLAMDDKLLVDAIADGGAEPAHLEIKV 117 >ref|NP_190965.1| proteasome inhibitor subunit 1 (PI31) [Arabidopsis thaliana] gi|18203248|sp|Q9M330.1|PSMF1_ARATH RecName: Full=Probable proteasome inhibitor gi|7630017|emb|CAB88359.1| putative protein [Arabidopsis thaliana] gi|17381084|gb|AAL36354.1| unknown protein [Arabidopsis thaliana] gi|21436237|gb|AAM51257.1| unknown protein [Arabidopsis thaliana] gi|332645645|gb|AEE79166.1| proteasome inhibitor subunit 1 (PI31) [Arabidopsis thaliana] Length = 302 Score = 72.0 bits (175), Expect = 5e-10 Identities = 35/57 (61%), Positives = 42/57 (73%), Gaps = 6/57 (10%) Frame = +2 Query: 2 VGIDGWDQFDDNYAFVYL------KKILVKCLAMNDTLLVDVLKNGGEEPLHLEINV 154 VGI+GW++F+ YAFVY KKILVKCLAM+D LLVD + +GG EP HLEI V Sbjct: 61 VGIEGWNEFEGEYAFVYANPKKGSKKILVKCLAMDDKLLVDAIADGGAEPAHLEIKV 117 >ref|XP_003632664.1| PREDICTED: probable proteasome inhibitor isoform 2 [Vitis vinifera] Length = 302 Score = 68.6 bits (166), Expect = 5e-09 Identities = 33/57 (57%), Positives = 40/57 (70%), Gaps = 6/57 (10%) Frame = +2 Query: 2 VGIDGWDQFDDNYAFVYL------KKILVKCLAMNDTLLVDVLKNGGEEPLHLEINV 154 VGI+ W++ D+YAFVY KK+LVKCL MND LLV L +G EP+HLEINV Sbjct: 61 VGIERWNELQDDYAFVYFNPEKGSKKVLVKCLVMNDKLLVAALADGASEPIHLEINV 117 >ref|XP_002275006.1| PREDICTED: probable proteasome inhibitor isoform 1 [Vitis vinifera] gi|297740291|emb|CBI30473.3| unnamed protein product [Vitis vinifera] Length = 296 Score = 68.6 bits (166), Expect = 5e-09 Identities = 33/57 (57%), Positives = 40/57 (70%), Gaps = 6/57 (10%) Frame = +2 Query: 2 VGIDGWDQFDDNYAFVYL------KKILVKCLAMNDTLLVDVLKNGGEEPLHLEINV 154 VGI+ W++ D+YAFVY KK+LVKCL MND LLV L +G EP+HLEINV Sbjct: 61 VGIERWNELQDDYAFVYFNPEKGSKKVLVKCLVMNDKLLVAALADGASEPIHLEINV 117