BLASTX nr result
ID: Cnidium21_contig00012939
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00012939 (359 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA66054.1| hypothetical protein [Beta vulgaris subsp. vulga... 78 9e-13 emb|CCA66044.1| hypothetical protein [Beta vulgaris subsp. vulga... 69 4e-10 emb|CCA66050.1| hypothetical protein [Beta vulgaris subsp. vulga... 59 3e-07 >emb|CCA66054.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1355 Score = 77.8 bits (190), Expect = 9e-13 Identities = 39/93 (41%), Positives = 55/93 (59%), Gaps = 9/93 (9%) Frame = -1 Query: 359 KVMKAKYLPNCSFLDAALGHSCSLTWKSIWSIKVLVKEGTSGR---------WEMVPKWL 207 +VMKAKY PNC FL+A LGHS S +W SIWS K L+KEG R W W+ Sbjct: 887 RVMKAKYFPNCDFLNAPLGHSSSYSWSSIWSSKALLKEGVIWRVGNGSQINMWS--DPWV 944 Query: 206 ASDDGRFVRSKEVADLTYVNDIIDMEAIVYRNS 108 + GRF+ S A + +V+++ID + + ++ S Sbjct: 945 LDEGGRFLTSTPHASIRWVSELIDFDRMEWKTS 977 >emb|CCA66044.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1355 Score = 68.9 bits (167), Expect = 4e-10 Identities = 39/97 (40%), Positives = 56/97 (57%), Gaps = 9/97 (9%) Frame = -1 Query: 359 KVMKAKYLPNCSFLDAALGHSCSLTWKSIWSIKVLVKEGTSGR---------WEMVPKWL 207 +VMKAKY N FLDA LG S S +W+SIWS K L+KEG R WE W+ Sbjct: 887 RVMKAKYYSNHDFLDAPLGVSTSYSWRSIWSSKALLKEGMVWRIGNGTNVRIWE--DPWV 944 Query: 206 ASDDGRFVRSKEVADLTYVNDIIDMEAIVYRNSTSPT 96 + GRF+ S++ +L V+++ID + + ++ S T Sbjct: 945 LDELGRFITSEKHGNLNMVSELIDFDRMEWKVSLIET 981 >emb|CCA66050.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1357 Score = 59.3 bits (142), Expect = 3e-07 Identities = 33/86 (38%), Positives = 46/86 (53%), Gaps = 9/86 (10%) Frame = -1 Query: 359 KVMKAKYLPNCSFLDAALGHSCSLTWKSIWSIKVLVKEGTSGR---------WEMVPKWL 207 +VM AKY P+ A LG+S S +W+SIW K LV EG R W W+ Sbjct: 890 RVMSAKYYPHGDVRYARLGYSHSYSWRSIWGAKSLVLEGLIWRVGDGTKIDIWS--APWV 947 Query: 206 ASDDGRFVRSKEVADLTYVNDIIDME 129 ++GRF++S V L V D++D+E Sbjct: 948 GDEEGRFIKSARVEGLEVVGDLMDVE 973