BLASTX nr result
ID: Cnidium21_contig00012674
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00012674 (349 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAA83082.1| LEDI-4 protein [Lithospermum erythrorhizon] 97 1e-18 gb|ABA81857.1| ripening regulated protein-like [Solanum tuberosum] 97 2e-18 ref|XP_002531075.1| conserved hypothetical protein [Ricinus comm... 93 3e-17 ref|XP_003605682.1| Quinone-oxidoreductase-like protein [Medicag... 92 3e-17 gb|AFB82645.1| quinone oxidoreductase [Camellia sinensis] 92 4e-17 >dbj|BAA83082.1| LEDI-4 protein [Lithospermum erythrorhizon] Length = 288 Score = 97.1 bits (240), Expect = 1e-18 Identities = 43/63 (68%), Positives = 50/63 (79%) Frame = -3 Query: 191 KLMKVVWYDTYGGGSTALKHAEAPVPAPLKDEVLIKVEASTINPIDSKIQGGMLRPVLPR 12 KLM+ VWY+ YGGG+ LKH E P+P P KDEVLIK EA ++NPID KIQ GM RP+LPR Sbjct: 4 KLMRAVWYEGYGGGAAKLKHVEIPIPKPSKDEVLIKFEAVSLNPIDCKIQEGMARPILPR 63 Query: 11 KFP 3 KFP Sbjct: 64 KFP 66 >gb|ABA81857.1| ripening regulated protein-like [Solanum tuberosum] Length = 329 Score = 96.7 bits (239), Expect = 2e-18 Identities = 43/63 (68%), Positives = 52/63 (82%) Frame = -3 Query: 191 KLMKVVWYDTYGGGSTALKHAEAPVPAPLKDEVLIKVEASTINPIDSKIQGGMLRPVLPR 12 K+M+ V YD+YGGG+ ALKH E PVP P KDEVL+KVEA++INP+D KIQ GM RP+LP Sbjct: 4 KIMQAVQYDSYGGGAAALKHVEVPVPTPTKDEVLVKVEATSINPLDCKIQKGMFRPLLPP 63 Query: 11 KFP 3 KFP Sbjct: 64 KFP 66 >ref|XP_002531075.1| conserved hypothetical protein [Ricinus communis] gi|223529321|gb|EEF31289.1| conserved hypothetical protein [Ricinus communis] Length = 109 Score = 92.8 bits (229), Expect = 3e-17 Identities = 40/63 (63%), Positives = 51/63 (80%) Frame = -3 Query: 191 KLMKVVWYDTYGGGSTALKHAEAPVPAPLKDEVLIKVEASTINPIDSKIQGGMLRPVLPR 12 KLM V YD YGGG+ LKH E PVP+P KDE+L+K+EA++INP+D KIQ G+LRP+ PR Sbjct: 4 KLMHAVQYDKYGGGAAGLKHVEVPVPSPKKDEILLKLEATSINPVDWKIQKGILRPIFPR 63 Query: 11 KFP 3 +FP Sbjct: 64 RFP 66 >ref|XP_003605682.1| Quinone-oxidoreductase-like protein [Medicago truncatula] gi|355506737|gb|AES87879.1| Quinone-oxidoreductase-like protein [Medicago truncatula] Length = 329 Score = 92.4 bits (228), Expect = 3e-17 Identities = 42/63 (66%), Positives = 51/63 (80%) Frame = -3 Query: 191 KLMKVVWYDTYGGGSTALKHAEAPVPAPLKDEVLIKVEASTINPIDSKIQGGMLRPVLPR 12 KLM V YD+YGGG + LKH E PVP P +EVLIK+EA++INP+D KIQ G+LRP+LPR Sbjct: 4 KLMHAVQYDSYGGGPSGLKHVEVPVPIPKTNEVLIKLEATSINPVDWKIQSGLLRPLLPR 63 Query: 11 KFP 3 KFP Sbjct: 64 KFP 66 >gb|AFB82645.1| quinone oxidoreductase [Camellia sinensis] Length = 330 Score = 92.0 bits (227), Expect = 4e-17 Identities = 43/63 (68%), Positives = 50/63 (79%) Frame = -3 Query: 191 KLMKVVWYDTYGGGSTALKHAEAPVPAPLKDEVLIKVEASTINPIDSKIQGGMLRPVLPR 12 KLM V YD+YGGG+ LKH E PVPAP K EVLIK+EA+++NPID KIQ GMLRP+ P Sbjct: 4 KLMHAVQYDSYGGGTAGLKHVEVPVPAPKKKEVLIKIEAASLNPIDWKIQKGMLRPLYPW 63 Query: 11 KFP 3 KFP Sbjct: 64 KFP 66