BLASTX nr result
ID: Cnidium21_contig00012624
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00012624 (293 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI17668.3| unnamed protein product [Vitis vinifera] 69 5e-10 ref|XP_002279901.1| PREDICTED: uncharacterized protein LOC100251... 69 5e-10 emb|CAN81170.1| hypothetical protein VITISV_022560 [Vitis vinifera] 63 3e-08 ref|XP_002512613.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 ref|XP_002325462.1| predicted protein [Populus trichocarpa] gi|2... 62 6e-08 >emb|CBI17668.3| unnamed protein product [Vitis vinifera] Length = 155 Score = 68.6 bits (166), Expect = 5e-10 Identities = 35/55 (63%), Positives = 42/55 (76%), Gaps = 2/55 (3%) Frame = -1 Query: 161 ETDPLTPSDEELL--NEEKIWEQIDALRAIVGYSAPMHATSVEEIKALYIFTGVE 3 E D S+EE + +EEKIWE+IDA+RAIVGY AP T VEE+KALY+FTGVE Sbjct: 73 EIDSTVKSNEEQVPESEEKIWERIDAMRAIVGYKAPSSRTCVEELKALYMFTGVE 127 >ref|XP_002279901.1| PREDICTED: uncharacterized protein LOC100251233 [Vitis vinifera] Length = 513 Score = 68.6 bits (166), Expect = 5e-10 Identities = 35/55 (63%), Positives = 42/55 (76%), Gaps = 2/55 (3%) Frame = -1 Query: 161 ETDPLTPSDEELL--NEEKIWEQIDALRAIVGYSAPMHATSVEEIKALYIFTGVE 3 E D S+EE + +EEKIWE+IDA+RAIVGY AP T VEE+KALY+FTGVE Sbjct: 431 EIDSTVKSNEEQVPESEEKIWERIDAMRAIVGYKAPSSRTCVEELKALYMFTGVE 485 >emb|CAN81170.1| hypothetical protein VITISV_022560 [Vitis vinifera] Length = 532 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -1 Query: 122 NEEKIWEQIDALRAIVGYSAPMHATSVEEIKALYIFTGVE 3 +EEKIWE+I A+RAIVGY AP T VEE+KALY+FTGVE Sbjct: 465 SEEKIWERIHAMRAIVGYKAPTSRTCVEELKALYMFTGVE 504 >ref|XP_002512613.1| conserved hypothetical protein [Ricinus communis] gi|223548574|gb|EEF50065.1| conserved hypothetical protein [Ricinus communis] Length = 501 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = -1 Query: 140 SDEELLNEEKIWEQIDALRAIVGYSAPMHATSVEEIKALYIFTGVE 3 S+E +EEK+WE+ID +R IVGY+A HAT + E+KALY+FTGVE Sbjct: 428 SNEMPDSEEKMWEKIDGMRKIVGYTAARHATCIGELKALYVFTGVE 473 >ref|XP_002325462.1| predicted protein [Populus trichocarpa] gi|222862337|gb|EEE99843.1| predicted protein [Populus trichocarpa] Length = 471 Score = 61.6 bits (148), Expect = 6e-08 Identities = 41/99 (41%), Positives = 59/99 (59%), Gaps = 2/99 (2%) Frame = -1 Query: 293 SYNDFNISQENDHIRSSKTGDVADLPFLRVSTKVAVSKHINLQPETD-PLTPSDEELL-N 120 SY D+ I + ++ + S K +V + T V SK + E D L + ++L + Sbjct: 352 SYADYRIPEGSEQL-SYKAYEVT------LPTTVDDSKCTGITSENDIHLAAGNVKVLYS 404 Query: 119 EEKIWEQIDALRAIVGYSAPMHATSVEEIKALYIFTGVE 3 E+KIW+QI A+R IVGY A + T +EE+KALYIFTGVE Sbjct: 405 EDKIWKQIRAVRTIVGYKASVRGTCIEELKALYIFTGVE 443