BLASTX nr result
ID: Cnidium21_contig00012589
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00012589 (284 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310760.1| predicted protein [Populus trichocarpa] gi|2... 70 2e-10 ref|XP_002522349.1| Polyneuridine-aldehyde esterase precursor, p... 65 6e-09 ref|XP_002522352.1| Polyneuridine-aldehyde esterase precursor, p... 63 2e-08 gb|AAU95203.1| protein S [Catharanthus roseus] 61 8e-08 ref|XP_002522347.1| hypothetical protein RCOM_0602860 [Ricinus c... 61 8e-08 >ref|XP_002310760.1| predicted protein [Populus trichocarpa] gi|222853663|gb|EEE91210.1| predicted protein [Populus trichocarpa] Length = 264 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -2 Query: 283 IQRWMIQLNPPDEVKVIQGSDHMTMFSKPQELSSFLLEIAQQH 155 IQRWMI+ NPPDEVKV+ GSDHM MFSKPQE+ S LLE+A ++ Sbjct: 221 IQRWMIEKNPPDEVKVVPGSDHMLMFSKPQEMCSCLLEVAGKY 263 >ref|XP_002522349.1| Polyneuridine-aldehyde esterase precursor, putative [Ricinus communis] gi|223538427|gb|EEF40033.1| Polyneuridine-aldehyde esterase precursor, putative [Ricinus communis] Length = 250 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -2 Query: 283 IQRWMIQLNPPDEVKVIQGSDHMTMFSKPQELSSFLLEIAQQH 155 +QRW+I+ NPPDEVKVI SDHM MFSKPQEL S L EIA+++ Sbjct: 207 LQRWVIRTNPPDEVKVIPDSDHMVMFSKPQELCSCLEEIAKKY 249 >ref|XP_002522352.1| Polyneuridine-aldehyde esterase precursor, putative [Ricinus communis] gi|223538430|gb|EEF40036.1| Polyneuridine-aldehyde esterase precursor, putative [Ricinus communis] Length = 260 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -2 Query: 283 IQRWMIQLNPPDEVKVIQGSDHMTMFSKPQELSSFLLEIAQQH 155 +QRWM++ NP DEVK+I GSDHM MFSKPQEL + L EIA+++ Sbjct: 217 MQRWMVKNNPTDEVKIIAGSDHMAMFSKPQELCACLEEIAKKY 259 >gb|AAU95203.1| protein S [Catharanthus roseus] Length = 258 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -2 Query: 280 QRWMIQLNPPDEVKVIQGSDHMTMFSKPQELSSFLLEIAQQH 155 QRWMI+ NP EVK I+G+DHM MFSKP ELS LL+IA++H Sbjct: 216 QRWMIENNPVKEVKEIKGADHMPMFSKPDELSQCLLDIAKKH 257 >ref|XP_002522347.1| hypothetical protein RCOM_0602860 [Ricinus communis] gi|223538425|gb|EEF40031.1| hypothetical protein RCOM_0602860 [Ricinus communis] Length = 118 Score = 61.2 bits (147), Expect = 8e-08 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 9/69 (13%) Frame = -2 Query: 283 IQRWMIQLNPPDEVKVIQGSDHMTMFSKPQELSSFLLEIAQQHCD*L*HCA--------- 131 +QRW++Q NPPD VK+I SDHM MFSKPQE S L EIA ++ + L A Sbjct: 45 LQRWVVQSNPPDWVKIIPDSDHMVMFSKPQEFCSCLEEIANKYMNYLFRVASGKSSMRSK 104 Query: 130 ILLSMFIIF 104 LL++ IIF Sbjct: 105 FLLNLCIIF 113