BLASTX nr result
ID: Cnidium21_contig00012585
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00012585 (430 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285244.1| PREDICTED: V-type proton ATPase 21 kDa prote... 97 3e-20 gb|AAO73433.1| vacuolar membrane ATPase subunit c'' [Citrus limon] 97 9e-20 ref|XP_002514355.1| vacuolar ATP synthase proteolipid subunit, p... 97 2e-19 ref|XP_002284783.2| PREDICTED: V-type proton ATPase 21 kDa prote... 97 9e-19 emb|CBI20975.3| unnamed protein product [Vitis vinifera] 97 9e-19 >ref|XP_002285244.1| PREDICTED: V-type proton ATPase 21 kDa proteolipid subunit isoform 1 [Vitis vinifera] gi|297743370|emb|CBI36237.3| unnamed protein product [Vitis vinifera] Length = 177 Score = 97.1 bits (240), Expect(2) = 3e-20 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = +3 Query: 279 ISPYTFSAIGIAVAIGVSVLGAAWGIYITGSSLIGAAIKAPRITSKNLIS 428 ISPYTFSAIGIA+AIGVSVLGAAWGIYITGSSLIGAAIKAPRITSKNLIS Sbjct: 15 ISPYTFSAIGIAIAIGVSVLGAAWGIYITGSSLIGAAIKAPRITSKNLIS 64 Score = 26.2 bits (56), Expect(2) = 3e-20 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 143 MVGGSSSWSRALL 181 MVG SSSWSRAL+ Sbjct: 1 MVGASSSWSRALV 13 >gb|AAO73433.1| vacuolar membrane ATPase subunit c'' [Citrus limon] Length = 182 Score = 97.4 bits (241), Expect(2) = 9e-20 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = +3 Query: 279 ISPYTFSAIGIAVAIGVSVLGAAWGIYITGSSLIGAAIKAPRITSKNLIS 428 ISPYTFSAIGIAVAIGVSVLGAAWGIYITGSSLIGAAIKAPRITSKNLIS Sbjct: 20 ISPYTFSAIGIAVAIGVSVLGAAWGIYITGSSLIGAAIKAPRITSKNLIS 69 Score = 24.3 bits (51), Expect(2) = 9e-20 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = +2 Query: 143 MVGGSSSWSRALL 181 M+G SSSWSRAL+ Sbjct: 6 MLGESSSWSRALV 18 >ref|XP_002514355.1| vacuolar ATP synthase proteolipid subunit, putative [Ricinus communis] gi|223546811|gb|EEF48309.1| vacuolar ATP synthase proteolipid subunit, putative [Ricinus communis] Length = 153 Score = 97.1 bits (240), Expect(2) = 2e-19 Identities = 49/50 (98%), Positives = 50/50 (100%) Frame = +3 Query: 279 ISPYTFSAIGIAVAIGVSVLGAAWGIYITGSSLIGAAIKAPRITSKNLIS 428 ISPYTFSA+GIAVAIGVSVLGAAWGIYITGSSLIGAAIKAPRITSKNLIS Sbjct: 20 ISPYTFSAVGIAVAIGVSVLGAAWGIYITGSSLIGAAIKAPRITSKNLIS 69 Score = 23.5 bits (49), Expect(2) = 2e-19 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = +2 Query: 143 MVGGSSSWSRALL 181 +VG +SSWSRAL+ Sbjct: 6 IVGNASSWSRALV 18 >ref|XP_002284783.2| PREDICTED: V-type proton ATPase 21 kDa proteolipid subunit [Vitis vinifera] Length = 222 Score = 97.4 bits (241), Expect(2) = 9e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = +3 Query: 279 ISPYTFSAIGIAVAIGVSVLGAAWGIYITGSSLIGAAIKAPRITSKNLIS 428 ISPYTFSAIGIAVAIGVSVLGAAWGIYITGSSLIGAAIKAPRITSKNLIS Sbjct: 60 ISPYTFSAIGIAVAIGVSVLGAAWGIYITGSSLIGAAIKAPRITSKNLIS 109 Score = 20.8 bits (42), Expect(2) = 9e-19 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 143 MVGGSSSWSRALL 181 M G SSSW+ AL+ Sbjct: 46 MAGPSSSWAHALV 58 >emb|CBI20975.3| unnamed protein product [Vitis vinifera] Length = 177 Score = 97.4 bits (241), Expect(2) = 9e-19 Identities = 50/50 (100%), Positives = 50/50 (100%) Frame = +3 Query: 279 ISPYTFSAIGIAVAIGVSVLGAAWGIYITGSSLIGAAIKAPRITSKNLIS 428 ISPYTFSAIGIAVAIGVSVLGAAWGIYITGSSLIGAAIKAPRITSKNLIS Sbjct: 15 ISPYTFSAIGIAVAIGVSVLGAAWGIYITGSSLIGAAIKAPRITSKNLIS 64 Score = 20.8 bits (42), Expect(2) = 9e-19 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 143 MVGGSSSWSRALL 181 M G SSSW+ AL+ Sbjct: 1 MAGPSSSWAHALV 13