BLASTX nr result
ID: Cnidium21_contig00012468
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00012468 (591 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002315157.1| predicted protein [Populus trichocarpa] gi|2... 74 2e-11 ref|XP_004137719.1| PREDICTED: CTD small phosphatase-like protei... 73 4e-11 gb|ADN33794.1| hypothetical protein [Cucumis melo subsp. melo] 73 4e-11 ref|XP_002533382.1| conserved hypothetical protein [Ricinus comm... 73 4e-11 ref|XP_002274356.1| PREDICTED: CTD small phosphatase-like protei... 72 7e-11 >ref|XP_002315157.1| predicted protein [Populus trichocarpa] gi|222864197|gb|EEF01328.1| predicted protein [Populus trichocarpa] Length = 261 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -2 Query: 230 LDLDETLVCAYETSSLRAILREQATKAGLKWFELECTSSDK 108 LDLDETLVCAYETSSL A LR QAT+AGLKWFEL+C SSDK Sbjct: 92 LDLDETLVCAYETSSLPAALRNQATEAGLKWFELDCISSDK 132 >ref|XP_004137719.1| PREDICTED: CTD small phosphatase-like protein 2-like [Cucumis sativus] gi|449523123|ref|XP_004168574.1| PREDICTED: CTD small phosphatase-like protein 2-like [Cucumis sativus] Length = 301 Score = 72.8 bits (177), Expect = 4e-11 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -2 Query: 230 LDLDETLVCAYETSSLRAILREQATKAGLKWFELECTSSDK 108 LDLDETLVCAYETSSL A+ R QAT+AGL WFELEC SSDK Sbjct: 104 LDLDETLVCAYETSSLPAVFRTQATEAGLNWFELECVSSDK 144 >gb|ADN33794.1| hypothetical protein [Cucumis melo subsp. melo] Length = 301 Score = 72.8 bits (177), Expect = 4e-11 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -2 Query: 230 LDLDETLVCAYETSSLRAILREQATKAGLKWFELECTSSDK 108 LDLDETLVCAYETSSL A+ R QAT+AGL WFELEC SSDK Sbjct: 104 LDLDETLVCAYETSSLPAVFRTQATEAGLNWFELECVSSDK 144 >ref|XP_002533382.1| conserved hypothetical protein [Ricinus communis] gi|223526775|gb|EEF29000.1| conserved hypothetical protein [Ricinus communis] Length = 267 Score = 72.8 bits (177), Expect = 4e-11 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -2 Query: 230 LDLDETLVCAYETSSLRAILREQATKAGLKWFELECTSSDK 108 LDLDETLVCAYETSSL A LR QAT AG+KWFELEC SSDK Sbjct: 106 LDLDETLVCAYETSSLPAALRNQATGAGVKWFELECVSSDK 146 >ref|XP_002274356.1| PREDICTED: CTD small phosphatase-like protein 2 isoform 2 [Vitis vinifera] Length = 298 Score = 72.0 bits (175), Expect = 7e-11 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = -2 Query: 251 SISIWGALDLDETLVCAYETSSLRAILREQATKAGLKWFELECTSSDK 108 S+ I LDLDETLVCAYETSSL A +R QA ++GLKWFELEC SSDK Sbjct: 88 SVQINVVLDLDETLVCAYETSSLPASIRNQAIESGLKWFELECVSSDK 135