BLASTX nr result
ID: Cnidium21_contig00012298
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00012298 (328 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527981.1| conserved hypothetical protein [Ricinus comm... 59 3e-07 ref|XP_002330772.1| predicted protein [Populus trichocarpa] gi|1... 57 2e-06 >ref|XP_002527981.1| conserved hypothetical protein [Ricinus communis] gi|223532607|gb|EEF34393.1| conserved hypothetical protein [Ricinus communis] Length = 440 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -1 Query: 328 PIIILFRICSTMFSKKQQKPNRTDNTNHSRRKAKRGHAEK 209 PII+L RICS +F KK +KP R NTNH+RRKAKRGH +K Sbjct: 401 PIILLSRICSAIFCKKAKKPIRHANTNHARRKAKRGHPDK 440 >ref|XP_002330772.1| predicted protein [Populus trichocarpa] gi|118485922|gb|ABK94806.1| unknown [Populus trichocarpa] gi|222872574|gb|EEF09705.1| predicted protein [Populus trichocarpa] Length = 446 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = -1 Query: 328 PIIILFRICSTMFSKKQQKPNRTDNTNHSRRKAKRGHAEK 209 PI IL R+CS++F KK +KP R T+HSRRKAKRGH +K Sbjct: 407 PIFILARVCSSIFCKKSKKPVRNAQTSHSRRKAKRGHPDK 446