BLASTX nr result
ID: Cnidium21_contig00012247
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00012247 (614 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001235168.1| uncharacterized protein LOC100306446 [Glycin... 134 2e-29 ref|XP_003548239.1| PREDICTED: CDGSH iron-sulfur domain-containi... 129 3e-28 ref|XP_002510894.1| conserved hypothetical protein [Ricinus comm... 128 9e-28 ref|XP_004143713.1| PREDICTED: CDGSH iron-sulfur domain-containi... 127 2e-27 emb|CBI24493.3| unnamed protein product [Vitis vinifera] 127 2e-27 >ref|NP_001235168.1| uncharacterized protein LOC100306446 [Glycine max] gi|255628565|gb|ACU14627.1| unknown [Glycine max] Length = 113 Score = 134 bits (336), Expect = 2e-29 Identities = 64/79 (81%), Positives = 71/79 (89%), Gaps = 2/79 (2%) Frame = +3 Query: 174 GNVKLRRTVKVRAE--SINPEIRKSEDKVVDSVDLTQLSKPITPYCRCWRSKTFPLCDGS 347 G V+ RR V V+AE SINP+IRKSE+KVVDSV +T+LSKP+TPYCRCWRS TFPLCDGS Sbjct: 35 GGVRTRRVVLVKAEAVSINPDIRKSEEKVVDSVVVTELSKPLTPYCRCWRSGTFPLCDGS 94 Query: 348 HVKHNKATGDNVGPLLLKK 404 HVKHNKATGDNVGPLLLKK Sbjct: 95 HVKHNKATGDNVGPLLLKK 113 >ref|XP_003548239.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Glycine max] Length = 113 Score = 129 bits (325), Expect = 3e-28 Identities = 62/74 (83%), Positives = 68/74 (91%), Gaps = 2/74 (2%) Frame = +3 Query: 189 RRTVKVRAE--SINPEIRKSEDKVVDSVDLTQLSKPITPYCRCWRSKTFPLCDGSHVKHN 362 RR V V+AE SINP+IRKSE+KVVDSV +T+LSKP+TPYCRCWRS TFPLCDGSHVKHN Sbjct: 40 RRVVLVKAEAVSINPDIRKSEEKVVDSVVVTELSKPLTPYCRCWRSGTFPLCDGSHVKHN 99 Query: 363 KATGDNVGPLLLKK 404 KATGDNVGPLLLKK Sbjct: 100 KATGDNVGPLLLKK 113 >ref|XP_002510894.1| conserved hypothetical protein [Ricinus communis] gi|223550009|gb|EEF51496.1| conserved hypothetical protein [Ricinus communis] Length = 111 Score = 128 bits (321), Expect = 9e-28 Identities = 66/106 (62%), Positives = 76/106 (71%), Gaps = 9/106 (8%) Frame = +3 Query: 117 MASITGFVGSALFSPARKPG-------NVKLRRTVKVRAES--INPEIRKSEDKVVDSVD 269 +A+ T +S +R G K RR + VRAE+ INP IRK E+KVVDSV Sbjct: 4 IAAATALAAGFCYSKSRVEGFKPTTHAAAKPRRMIAVRAEAQGINPAIRKDEEKVVDSVM 63 Query: 270 LTQLSKPITPYCRCWRSKTFPLCDGSHVKHNKATGDNVGPLLLKKQ 407 + +LSKP+TPYCRCWRS TFPLCDGSHVKHNKATGDNVGPLLLKKQ Sbjct: 64 VAELSKPLTPYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKKQ 109 >ref|XP_004143713.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Cucumis sativus] gi|449506515|ref|XP_004162771.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Cucumis sativus] Length = 108 Score = 127 bits (319), Expect = 2e-27 Identities = 63/78 (80%), Positives = 66/78 (84%), Gaps = 6/78 (7%) Frame = +3 Query: 189 RRTVKVRAES------INPEIRKSEDKVVDSVDLTQLSKPITPYCRCWRSKTFPLCDGSH 350 RRTV VRAE INP IRKSEDKVVDSV + +LSKP+TPYCRCWRS TFPLCDGSH Sbjct: 31 RRTVVVRAEGGSSGEHINPAIRKSEDKVVDSVLVPELSKPLTPYCRCWRSGTFPLCDGSH 90 Query: 351 VKHNKATGDNVGPLLLKK 404 VKHNKATGDNVGPLLLKK Sbjct: 91 VKHNKATGDNVGPLLLKK 108 >emb|CBI24493.3| unnamed protein product [Vitis vinifera] Length = 97 Score = 127 bits (319), Expect = 2e-27 Identities = 59/72 (81%), Positives = 65/72 (90%) Frame = +3 Query: 189 RRTVKVRAESINPEIRKSEDKVVDSVDLTQLSKPITPYCRCWRSKTFPLCDGSHVKHNKA 368 RR V VRAE+INPEIRK E+KVVDSV + +L+KP+T YCRCWRS TFPLCDGSHVKHNKA Sbjct: 26 RRAVVVRAETINPEIRKIEEKVVDSVLVAELAKPVTAYCRCWRSGTFPLCDGSHVKHNKA 85 Query: 369 TGDNVGPLLLKK 404 TGDNVGPLLLKK Sbjct: 86 TGDNVGPLLLKK 97