BLASTX nr result
ID: Cnidium21_contig00012087
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00012087 (582 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003418843.1| PREDICTED: 40S ribosomal protein S15a-like [... 63 3e-20 gb|EFR24138.1| hypothetical protein AND_11488 [Anopheles darlingi] 59 3e-18 sp|Q9AT34.3|RS15A_DAUCA RecName: Full=40S ribosomal protein S15a... 89 7e-16 gb|ACF06470.1| cytoplasmic ribosomal protein S15a [Elaeis guinee... 89 7e-16 gb|AEO34861.1| hypothetical protein [Amblyomma maculatum] 87 2e-15 >ref|XP_003418843.1| PREDICTED: 40S ribosomal protein S15a-like [Loxodonta africana] Length = 130 Score = 63.2 bits (152), Expect(2) = 3e-20 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -3 Query: 577 LNGRLNKCGVISPRFDVGVKEIEPWTARLLPSRQFGF 467 L GRLNKCGVISPRFDV +K++E W LLPSRQFGF Sbjct: 65 LTGRLNKCGVISPRFDVQLKDLEKWQNNLLPSRQFGF 101 Score = 60.8 bits (146), Expect(2) = 3e-20 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -2 Query: 404 LPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 294 LPSRQFG+ SAGIMDHEEARRK+ GGK+LGFF+ Sbjct: 94 LPSRQFGFSCTDDSAGIMDHEEARRKHTGGKILGFFF 130 >gb|EFR24138.1| hypothetical protein AND_11488 [Anopheles darlingi] Length = 170 Score = 58.9 bits (141), Expect(2) = 3e-18 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 577 LNGRLNKCGVISPRFDVGVKEIEPWTARLLPSRQFGFI 464 L GRLNK G+ISPRFDV + +IE WT LLPSRQFG++ Sbjct: 65 LTGRLNKAGIISPRFDVKLHDIERWTNDLLPSRQFGYV 102 Score = 58.2 bits (139), Expect(2) = 3e-18 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -2 Query: 398 SRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 294 S F Y+VLTTS GIMDHEEARRK++GGK+LG+F+ Sbjct: 136 SDPFRYVVLTTSGGIMDHEEARRKHLGGKILGYFF 170 >sp|Q9AT34.3|RS15A_DAUCA RecName: Full=40S ribosomal protein S15a gi|13560779|gb|AAK30203.1|AF349962_1 cytoplasmic ribosomal protein S15a [Daucus carota] Length = 130 Score = 88.6 bits (218), Expect = 7e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 580 ELNGRLNKCGVISPRFDVGVKEIEPWTARLLPSRQFGFIVLT 455 ELNGRLNKCGVISPRFDVGVKEIEPWTARLLPSRQFG+IVLT Sbjct: 64 ELNGRLNKCGVISPRFDVGVKEIEPWTARLLPSRQFGYIVLT 105 Score = 78.6 bits (192), Expect = 7e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 404 LPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 294 LPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 94 LPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >gb|ACF06470.1| cytoplasmic ribosomal protein S15a [Elaeis guineensis] gi|192910726|gb|ACF06471.1| cytoplasmic ribosomal protein S15a [Elaeis guineensis] Length = 130 Score = 88.6 bits (218), Expect = 7e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -3 Query: 580 ELNGRLNKCGVISPRFDVGVKEIEPWTARLLPSRQFGFIVLT 455 ELNGRLNKCGVISPRFDVGVKEIEPWTARLLPSRQFG+IVLT Sbjct: 64 ELNGRLNKCGVISPRFDVGVKEIEPWTARLLPSRQFGYIVLT 105 Score = 78.6 bits (192), Expect = 7e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 404 LPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 294 LPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 94 LPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >gb|AEO34861.1| hypothetical protein [Amblyomma maculatum] Length = 130 Score = 87.4 bits (215), Expect = 2e-15 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = -3 Query: 580 ELNGRLNKCGVISPRFDVGVKEIEPWTARLLPSRQFGFIVLT 455 ELNGRLNKCGVISPRFDVGVK+IEPWTARLLPSRQFG+IVLT Sbjct: 64 ELNGRLNKCGVISPRFDVGVKDIEPWTARLLPSRQFGYIVLT 105 Score = 78.6 bits (192), Expect = 7e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -2 Query: 404 LPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 294 LPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 94 LPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130