BLASTX nr result
ID: Cnidium21_contig00011645
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00011645 (454 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004147236.1| PREDICTED: ATP-dependent Clp protease proteo... 83 2e-14 ref|XP_003635562.1| PREDICTED: ATP-dependent Clp protease proteo... 83 2e-14 ref|XP_003635075.1| PREDICTED: ATP-dependent Clp protease proteo... 83 2e-14 emb|CBI40932.3| unnamed protein product [Vitis vinifera] 83 2e-14 emb|CBI29573.3| unnamed protein product [Vitis vinifera] 83 2e-14 >ref|XP_004147236.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit-related protein 4, chloroplastic-like [Cucumis sativus] gi|449510487|ref|XP_004163680.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit-related protein 4, chloroplastic-like [Cucumis sativus] Length = 304 Score = 83.2 bits (204), Expect = 2e-14 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = +3 Query: 3 DIRRPKYFSPSEALEYGIIDKVLYNERGSEDRGVLSDLKKSQLI 134 DIRRPKYFSPSEA+EYGIIDKVLYNER +EDRGV+SDLKK+QLI Sbjct: 261 DIRRPKYFSPSEAVEYGIIDKVLYNERATEDRGVVSDLKKAQLI 304 >ref|XP_003635562.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit-related protein 4, chloroplastic-like, partial [Vitis vinifera] Length = 129 Score = 83.2 bits (204), Expect = 2e-14 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = +3 Query: 3 DIRRPKYFSPSEALEYGIIDKVLYNERGSEDRGVLSDLKKSQLI 134 DIRRPKYFSPSEA+EYGIIDKVLYNER SEDRGV++DLKK+QLI Sbjct: 86 DIRRPKYFSPSEAVEYGIIDKVLYNERSSEDRGVVADLKKAQLI 129 >ref|XP_003635075.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit-related protein 4, chloroplastic-like [Vitis vinifera] Length = 297 Score = 83.2 bits (204), Expect = 2e-14 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = +3 Query: 3 DIRRPKYFSPSEALEYGIIDKVLYNERGSEDRGVLSDLKKSQLI 134 DIRRPKYFSPSEA+EYGIIDKVLYNER SEDRGV++DLKK+QLI Sbjct: 254 DIRRPKYFSPSEAVEYGIIDKVLYNERSSEDRGVVADLKKAQLI 297 >emb|CBI40932.3| unnamed protein product [Vitis vinifera] Length = 282 Score = 83.2 bits (204), Expect = 2e-14 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = +3 Query: 3 DIRRPKYFSPSEALEYGIIDKVLYNERGSEDRGVLSDLKKSQLI 134 DIRRPKYFSPSEA+EYGIIDKVLYNER SEDRGV++DLKK+QLI Sbjct: 239 DIRRPKYFSPSEAVEYGIIDKVLYNERSSEDRGVVADLKKAQLI 282 >emb|CBI29573.3| unnamed protein product [Vitis vinifera] Length = 91 Score = 83.2 bits (204), Expect = 2e-14 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = +3 Query: 3 DIRRPKYFSPSEALEYGIIDKVLYNERGSEDRGVLSDLKKSQLI 134 DIRRPKYFSPSEA+EYGIIDKVLYNER SEDRGV++DLKK+QLI Sbjct: 48 DIRRPKYFSPSEAVEYGIIDKVLYNERSSEDRGVVADLKKAQLI 91