BLASTX nr result
ID: Cnidium21_contig00011414
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00011414 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513860.1| conserved hypothetical protein [Ricinus comm... 57 1e-06 >ref|XP_002513860.1| conserved hypothetical protein [Ricinus communis] gi|223546946|gb|EEF48443.1| conserved hypothetical protein [Ricinus communis] Length = 79 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/66 (43%), Positives = 40/66 (60%), Gaps = 1/66 (1%) Frame = -2 Query: 198 MSTMSYGLAEVYVMKKLHKEKMRK-MESATKKDGIHTKEDAVDHKEKNGCFPMMFKKIHP 22 M+T Y LAE +V + LHKEKM+K E K +G + ++ K+ GCFP MFKK+HP Sbjct: 1 MATAGYALAEAHVQRTLHKEKMKKSKEERAKVEGFN-----LEVKQSTGCFPSMFKKVHP 55 Query: 21 NTNSSS 4 +S Sbjct: 56 AARLAS 61