BLASTX nr result
ID: Cnidium21_contig00011284
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00011284 (507 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002302044.1| predicted protein [Populus trichocarpa] gi|2... 93 2e-17 gb|AEC10997.1| hypothetical protein [Camellia sinensis] 93 3e-17 ref|XP_002532032.1| conserved hypothetical protein [Ricinus comm... 92 3e-17 emb|CAE01583.2| OSJNBa0068L06.9 [Oryza sativa Japonica Group] gi... 92 4e-17 emb|CBI37125.3| unnamed protein product [Vitis vinifera] 92 4e-17 >ref|XP_002302044.1| predicted protein [Populus trichocarpa] gi|222843770|gb|EEE81317.1| predicted protein [Populus trichocarpa] Length = 205 Score = 93.2 bits (230), Expect = 2e-17 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = +1 Query: 52 KDPEKSENHLVRRLAAVEGYEMVSKDEKEEPFVLEKDQCWVLADNENLKPK 204 KDPEKS+N LVRRLAA+EGYEMVS DEK++PFVL+KD+CWVLADN+ LKPK Sbjct: 93 KDPEKSDNFLVRRLAAIEGYEMVSTDEKDDPFVLDKDECWVLADNDKLKPK 143 >gb|AEC10997.1| hypothetical protein [Camellia sinensis] Length = 146 Score = 92.8 bits (229), Expect = 3e-17 Identities = 41/51 (80%), Positives = 47/51 (92%) Frame = +1 Query: 52 KDPEKSENHLVRRLAAVEGYEMVSKDEKEEPFVLEKDQCWVLADNENLKPK 204 KDP ++N+ VRRLAA+EGYEMVS DEK+EPFVLEKDQCWVL+DNENLKPK Sbjct: 34 KDPVNTDNYFVRRLAAIEGYEMVSTDEKDEPFVLEKDQCWVLSDNENLKPK 84 >ref|XP_002532032.1| conserved hypothetical protein [Ricinus communis] gi|223528302|gb|EEF30348.1| conserved hypothetical protein [Ricinus communis] Length = 137 Score = 92.4 bits (228), Expect = 3e-17 Identities = 42/51 (82%), Positives = 46/51 (90%) Frame = +1 Query: 52 KDPEKSENHLVRRLAAVEGYEMVSKDEKEEPFVLEKDQCWVLADNENLKPK 204 KDP+ ++N LVRRLAAVEGYEMVS DEK+EPFVLE DQCWVLADNE LKPK Sbjct: 24 KDPDNTDNFLVRRLAAVEGYEMVSSDEKDEPFVLENDQCWVLADNEKLKPK 74 >emb|CAE01583.2| OSJNBa0068L06.9 [Oryza sativa Japonica Group] gi|116317777|emb|CAH65755.1| OSIGBa0123D13.4 [Oryza sativa Indica Group] gi|125546927|gb|EAY92749.1| hypothetical protein OsI_14504 [Oryza sativa Indica Group] gi|125589074|gb|EAZ29424.1| hypothetical protein OsJ_13497 [Oryza sativa Japonica Group] gi|215697911|dbj|BAG92153.1| unnamed protein product [Oryza sativa Japonica Group] gi|215737534|dbj|BAG96664.1| unnamed protein product [Oryza sativa Japonica Group] Length = 206 Score = 92.0 bits (227), Expect = 4e-17 Identities = 41/51 (80%), Positives = 49/51 (96%) Frame = +1 Query: 52 KDPEKSENHLVRRLAAVEGYEMVSKDEKEEPFVLEKDQCWVLADNENLKPK 204 KDPEKS++ +VRRLAA+EGYEMVS DEK+EPFVL+KDQCWVLADN++LKPK Sbjct: 94 KDPEKSDDLIVRRLAALEGYEMVSNDEKDEPFVLDKDQCWVLADNQSLKPK 144 >emb|CBI37125.3| unnamed protein product [Vitis vinifera] Length = 244 Score = 92.0 bits (227), Expect = 4e-17 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = +1 Query: 52 KDPEKSENHLVRRLAAVEGYEMVSKDEKEEPFVLEKDQCWVLADNENLKP 201 KDPE+S+N+LVRRLAAVEGYEM S DEK+EPFVLEKDQCWVL+DNE LKP Sbjct: 132 KDPEESDNYLVRRLAAVEGYEMGSTDEKDEPFVLEKDQCWVLSDNETLKP 181