BLASTX nr result
ID: Cnidium21_contig00011180
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00011180 (568 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004157169.1| PREDICTED: methionine aminopeptidase 2B-like... 64 2e-08 ref|XP_004140818.1| PREDICTED: methionine aminopeptidase 2B-like... 64 2e-08 gb|ADE77044.1| unknown [Picea sitchensis] 62 5e-08 ref|XP_002444652.1| hypothetical protein SORBIDRAFT_07g025460 [S... 62 5e-08 ref|XP_002270461.1| PREDICTED: methionine aminopeptidase 2B-like... 62 5e-08 >ref|XP_004157169.1| PREDICTED: methionine aminopeptidase 2B-like [Cucumis sativus] Length = 436 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 201 YPPLCDDKGSHVSQFEHTILLRPTWKEVVSRG 296 YPPLCD KGS+VSQFEHTILLRPT KEV+SRG Sbjct: 402 YPPLCDSKGSYVSQFEHTILLRPTCKEVISRG 433 >ref|XP_004140818.1| PREDICTED: methionine aminopeptidase 2B-like [Cucumis sativus] Length = 509 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 201 YPPLCDDKGSHVSQFEHTILLRPTWKEVVSRG 296 YPPLCD KGS+VSQFEHTILLRPT KEV+SRG Sbjct: 475 YPPLCDSKGSYVSQFEHTILLRPTCKEVISRG 506 >gb|ADE77044.1| unknown [Picea sitchensis] Length = 476 Score = 62.4 bits (150), Expect = 5e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 201 YPPLCDDKGSHVSQFEHTILLRPTWKEVVSRG 296 YPPLCD KGS+VSQFEHTILLRPT KEV+SRG Sbjct: 442 YPPLCDIKGSYVSQFEHTILLRPTCKEVISRG 473 >ref|XP_002444652.1| hypothetical protein SORBIDRAFT_07g025460 [Sorghum bicolor] gi|241941002|gb|EES14147.1| hypothetical protein SORBIDRAFT_07g025460 [Sorghum bicolor] Length = 446 Score = 62.4 bits (150), Expect = 5e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 201 YPPLCDDKGSHVSQFEHTILLRPTWKEVVSRG 296 YPPLCD KGS+VSQFEHTILLRPT KEV+SRG Sbjct: 412 YPPLCDVKGSYVSQFEHTILLRPTCKEVISRG 443 >ref|XP_002270461.1| PREDICTED: methionine aminopeptidase 2B-like [Vitis vinifera] Length = 421 Score = 62.4 bits (150), Expect = 5e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 201 YPPLCDDKGSHVSQFEHTILLRPTWKEVVSRG 296 YPPLCD KGS+VSQFEHTILLRPT KEV+SRG Sbjct: 387 YPPLCDVKGSYVSQFEHTILLRPTCKEVISRG 418