BLASTX nr result
ID: Cnidium21_contig00011104
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00011104 (333 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF07192.1|AF193846_1 branched-chain amino acid aminotransfer... 91 1e-16 ref|XP_002530599.1| branched-chain amino acid aminotransferase, ... 90 2e-16 ref|XP_002310326.1| predicted protein [Populus trichocarpa] gi|2... 90 2e-16 gb|AAF07191.1|AF193845_1 branched-chain amino acid aminotransfer... 89 4e-16 gb|AAM65160.1| branched-chain-amino-acid transaminase-like prote... 88 8e-16 >gb|AAF07192.1|AF193846_1 branched-chain amino acid aminotransferase [Solanum tuberosum] Length = 377 Score = 90.5 bits (223), Expect = 1e-16 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -2 Query: 332 WIPPPGKGSLYIRPLLMGSGSVLSLAPASEFTFLIYVSPVGNYFK 198 WIPPPGKGSLYIRPLLMGSG+VL LAPA E+TFLIYVSPVGNYFK Sbjct: 153 WIPPPGKGSLYIRPLLMGSGAVLGLAPAPEYTFLIYVSPVGNYFK 197 >ref|XP_002530599.1| branched-chain amino acid aminotransferase, putative [Ricinus communis] gi|223529847|gb|EEF31779.1| branched-chain amino acid aminotransferase, putative [Ricinus communis] Length = 417 Score = 90.1 bits (222), Expect = 2e-16 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -2 Query: 332 WIPPPGKGSLYIRPLLMGSGSVLSLAPASEFTFLIYVSPVGNYFK 198 W+PPPGKGSLYIRPLLMGSG+VL LAPA E+TFLIYVSPVGNYFK Sbjct: 193 WVPPPGKGSLYIRPLLMGSGAVLGLAPAPEYTFLIYVSPVGNYFK 237 >ref|XP_002310326.1| predicted protein [Populus trichocarpa] gi|222853229|gb|EEE90776.1| predicted protein [Populus trichocarpa] Length = 410 Score = 90.1 bits (222), Expect = 2e-16 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -2 Query: 332 WIPPPGKGSLYIRPLLMGSGSVLSLAPASEFTFLIYVSPVGNYFK 198 W+PPPGKGSLYIRPLLMGSG+VL LAPA E+TFLIYVSPVGNYFK Sbjct: 189 WVPPPGKGSLYIRPLLMGSGAVLGLAPAPEYTFLIYVSPVGNYFK 233 >gb|AAF07191.1|AF193845_1 branched-chain amino acid aminotransferase [Solanum tuberosum] Length = 418 Score = 89.0 bits (219), Expect = 4e-16 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -2 Query: 332 WIPPPGKGSLYIRPLLMGSGSVLSLAPASEFTFLIYVSPVGNYFK 198 WIPPPGKGSLYIRPLLMGSG++L +APA E+TFLIYVSPVGNYFK Sbjct: 194 WIPPPGKGSLYIRPLLMGSGAILGVAPAPEYTFLIYVSPVGNYFK 238 >gb|AAM65160.1| branched-chain-amino-acid transaminase-like protein [Arabidopsis thaliana] Length = 413 Score = 87.8 bits (216), Expect = 8e-16 Identities = 37/45 (82%), Positives = 43/45 (95%) Frame = -2 Query: 332 WIPPPGKGSLYIRPLLMGSGSVLSLAPASEFTFLIYVSPVGNYFK 198 W+PPPGKGSLY+RPLLMG+G+VL LAPA E+TF+IYVSPVGNYFK Sbjct: 189 WVPPPGKGSLYVRPLLMGTGAVLGLAPAPEYTFIIYVSPVGNYFK 233