BLASTX nr result
ID: Cnidium21_contig00011072
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00011072 (481 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAP41026.1| NTA15 protein [Nicotiana tabacum] 61 1e-07 gb|AAK08655.1|AF234536_1 senescence-associated protein [Ipomoea ... 57 2e-06 ref|XP_002531181.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 ref|XP_002302950.1| predicted protein [Populus trichocarpa] gi|1... 56 3e-06 ref|NP_564872.1| putative senescence-associated protein [Arabido... 55 4e-06 >gb|AAP41026.1| NTA15 protein [Nicotiana tabacum] Length = 421 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 481 GEVSADRITAIQEAYRDIASGLSEADGVDYSDP 383 GEVSADRITAIQEAY DIAS LSEADG+DY+DP Sbjct: 280 GEVSADRITAIQEAYWDIASALSEADGIDYTDP 312 >gb|AAK08655.1|AF234536_1 senescence-associated protein [Ipomoea batatas] gi|33341118|gb|AAQ15125.1|AF353614_1 senescence-associated protein SPA15 [Ipomoea batatas] Length = 420 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -1 Query: 481 GEVSADRITAIQEAYRDIASGLSEADGVDYSDP 383 GEVSA+RI+AIQEAY DIA+ LSEADG+DY+DP Sbjct: 283 GEVSAERISAIQEAYWDIAAALSEADGIDYTDP 315 >ref|XP_002531181.1| conserved hypothetical protein [Ricinus communis] gi|223529222|gb|EEF31196.1| conserved hypothetical protein [Ricinus communis] Length = 457 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 481 GEVSADRITAIQEAYRDIASGLSEADGVDYSDP 383 GEVS DRITAIQEAY +AS LSEADG+DY+DP Sbjct: 306 GEVSTDRITAIQEAYWSMASALSEADGIDYTDP 338 >ref|XP_002302950.1| predicted protein [Populus trichocarpa] gi|118488010|gb|ABK95826.1| unknown [Populus trichocarpa] gi|222844676|gb|EEE82223.1| predicted protein [Populus trichocarpa] Length = 460 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 481 GEVSADRITAIQEAYRDIASGLSEADGVDYSDP 383 GEVS DRITAIQEAY +AS LSEADG+DY+DP Sbjct: 309 GEVSTDRITAIQEAYWSMASALSEADGIDYTDP 341 >ref|NP_564872.1| putative senescence-associated protein [Arabidopsis thaliana] gi|42572009|ref|NP_974095.1| putative senescence-associated protein [Arabidopsis thaliana] gi|12324400|gb|AAG52167.1|AC020665_12 unknown protein; 33791-31527 [Arabidopsis thaliana] gi|332196374|gb|AEE34495.1| putative senescence-associated protein [Arabidopsis thaliana] gi|332196375|gb|AEE34496.1| putative senescence-associated protein [Arabidopsis thaliana] Length = 417 Score = 55.5 bits (132), Expect = 4e-06 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = -1 Query: 481 GEVSADRITAIQEAYRDIASGLSEADGVDYSDP 383 GEVS+DRI+AI+EAY+ +AS LSEADG+DY+DP Sbjct: 268 GEVSSDRISAIEEAYKSMASALSEADGIDYTDP 300