BLASTX nr result
ID: Cnidium21_contig00010956
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00010956 (1309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531134.1| alanyl-tRNA synthetase, putative [Ricinus co... 73 1e-10 gb|AAD50044.1|AC007980_9 cytosolic tRNA-Ala synthetase [Arabidop... 73 2e-10 pir||S32671 alanine-tRNA ligase (EC 6.1.1.7) - Arabidopsis thali... 73 2e-10 emb|CAA80380.1| mitochondrial tRNA-Ala synthetase [Arabidopsis t... 73 2e-10 ref|NP_001185186.1| Alanyl-tRNA synthetase [Arabidopsis thaliana... 73 2e-10 >ref|XP_002531134.1| alanyl-tRNA synthetase, putative [Ricinus communis] gi|223529283|gb|EEF31254.1| alanyl-tRNA synthetase, putative [Ricinus communis] Length = 1025 Score = 73.2 bits (178), Expect = 1e-10 Identities = 33/50 (66%), Positives = 41/50 (82%) Frame = +1 Query: 229 GKLPSVQDVFLLWDIYSFPLDLTQLLANERVLMVDVDGFNKAINESRERS 378 GK+ +QD F+LWD Y FPLDLTQL+A ER L VDV+GFN A++E+RERS Sbjct: 477 GKVSCLQDAFVLWDTYGFPLDLTQLMAEERGLWVDVEGFNNAMDEARERS 526 >gb|AAD50044.1|AC007980_9 cytosolic tRNA-Ala synthetase [Arabidopsis thaliana] gi|27311841|gb|AAO00886.1| Unknown protein [Arabidopsis thaliana] gi|31711780|gb|AAP68246.1| At1g50200 [Arabidopsis thaliana] Length = 955 Score = 72.8 bits (177), Expect = 2e-10 Identities = 34/50 (68%), Positives = 39/50 (78%) Frame = +1 Query: 229 GKLPSVQDVFLLWDIYSFPLDLTQLLANERVLMVDVDGFNKAINESRERS 378 G S D F+LWD Y FPLDLTQL+A ER L+VDVDGFNKA+ E+RERS Sbjct: 407 GNTLSGDDAFILWDTYGFPLDLTQLMAEERGLLVDVDGFNKAMEEARERS 456 >pir||S32671 alanine-tRNA ligase (EC 6.1.1.7) - Arabidopsis thaliana (fragment) Length = 989 Score = 72.8 bits (177), Expect = 2e-10 Identities = 34/50 (68%), Positives = 39/50 (78%) Frame = +1 Query: 229 GKLPSVQDVFLLWDIYSFPLDLTQLLANERVLMVDVDGFNKAINESRERS 378 G S D F+LWD Y FPLDLTQL+A ER L+VDVDGFNKA+ E+RERS Sbjct: 441 GNTLSGDDAFILWDTYGFPLDLTQLMAEERGLLVDVDGFNKAMEEARERS 490 >emb|CAA80380.1| mitochondrial tRNA-Ala synthetase [Arabidopsis thaliana] Length = 1003 Score = 72.8 bits (177), Expect = 2e-10 Identities = 34/50 (68%), Positives = 39/50 (78%) Frame = +1 Query: 229 GKLPSVQDVFLLWDIYSFPLDLTQLLANERVLMVDVDGFNKAINESRERS 378 G S D F+LWD Y FPLDLTQL+A ER L+VDVDGFNKA+ E+RERS Sbjct: 455 GNTLSGDDAFILWDTYGFPLDLTQLMAEERGLLVDVDGFNKAMEEARERS 504 >ref|NP_001185186.1| Alanyl-tRNA synthetase [Arabidopsis thaliana] gi|332194404|gb|AEE32525.1| Alanyl-tRNA synthetase [Arabidopsis thaliana] Length = 963 Score = 72.8 bits (177), Expect = 2e-10 Identities = 34/50 (68%), Positives = 39/50 (78%) Frame = +1 Query: 229 GKLPSVQDVFLLWDIYSFPLDLTQLLANERVLMVDVDGFNKAINESRERS 378 G S D F+LWD Y FPLDLTQL+A ER L+VDVDGFNKA+ E+RERS Sbjct: 407 GNTLSGDDAFILWDTYGFPLDLTQLMAEERGLLVDVDGFNKAMEEARERS 456