BLASTX nr result
ID: Cnidium21_contig00010929
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00010929 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACW83616.2| mevalonate diphosphate decarboxylase [Panax ginseng] 62 4e-08 ref|XP_003555870.1| PREDICTED: diphosphomevalonate decarboxylase... 62 6e-08 ref|XP_003536712.1| PREDICTED: diphosphomevalonate decarboxylase... 61 8e-08 gb|ADI80345.1| mevalonate diphosphate decarboxylase [Panax ginseng] 61 8e-08 gb|AEM42974.1| diphosphomevalonate decarboxylase [Siraitia grosv... 60 1e-07 >gb|ACW83616.2| mevalonate diphosphate decarboxylase [Panax ginseng] Length = 417 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 357 GDVSYFICTRPGRGPTVLSDSQALLNHETGLPK 259 GDVSYFICTRPGRGP +L DS+ALLN ETGLPK Sbjct: 385 GDVSYFICTRPGRGPVLLPDSRALLNPETGLPK 417 >ref|XP_003555870.1| PREDICTED: diphosphomevalonate decarboxylase-like [Glycine max] Length = 421 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 1/34 (2%) Frame = -1 Query: 357 GDVSYFICTRPGRGPTVLSDS-QALLNHETGLPK 259 GDVSYFICTRPGRGP +LSDS QALLN ETGLPK Sbjct: 388 GDVSYFICTRPGRGPVLLSDSIQALLNDETGLPK 421 >ref|XP_003536712.1| PREDICTED: diphosphomevalonate decarboxylase-like [Glycine max] Length = 420 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 1/34 (2%) Frame = -1 Query: 357 GDVSYFICTRPGRGPTVLSD-SQALLNHETGLPK 259 GDVSYFICTRPGRGP +LSD SQALLN ETGLPK Sbjct: 387 GDVSYFICTRPGRGPVLLSDSSQALLNGETGLPK 420 >gb|ADI80345.1| mevalonate diphosphate decarboxylase [Panax ginseng] Length = 420 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 357 GDVSYFICTRPGRGPTVLSDSQALLNHETGLPK 259 GDVSYFICTRPGRGP +L DS ALLN ETGLPK Sbjct: 388 GDVSYFICTRPGRGPVLLPDSGALLNPETGLPK 420 >gb|AEM42974.1| diphosphomevalonate decarboxylase [Siraitia grosvenorii] Length = 418 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -1 Query: 357 GDVSYFICTRPGRGPTVLSDSQALLNHETGLPK 259 GDVSYFICTRPG+GP VL DSQALL+ +TGLPK Sbjct: 384 GDVSYFICTRPGKGPVVLPDSQALLDPKTGLPK 416