BLASTX nr result
ID: Cnidium21_contig00010785
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00010785 (289 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAS92255.1| putative pyridoxine biosynthesis protein isoform ... 69 5e-10 gb|AAZ67141.1| pyridoxine biosynthesis protein [Lotus japonicus] 66 3e-09 sp|Q39963.1|PDX1_HEVBR RecName: Full=Probable pyridoxal biosynth... 65 4e-09 ref|XP_002308219.1| predicted protein [Populus trichocarpa] gi|2... 65 4e-09 ref|XP_003593782.1| Pyridoxal biosynthesis protein PDX1.3 [Medic... 65 6e-09 >gb|AAS92255.1| putative pyridoxine biosynthesis protein isoform A [Nicotiana tabacum] gi|46399271|gb|AAS92256.1| putative pyridoxine biosynthesis protein isoform B [Nicotiana tabacum] Length = 309 Score = 68.6 bits (166), Expect = 5e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +1 Query: 1 VTHYSDPLMLAEISCGLGEAMVGLNLDKNVERYASRSE 114 VTHYSDP +LAEISCGLGEAMVG+NLD VERYA+RSE Sbjct: 272 VTHYSDPGLLAEISCGLGEAMVGINLDDKVERYANRSE 309 >gb|AAZ67141.1| pyridoxine biosynthesis protein [Lotus japonicus] Length = 310 Score = 65.9 bits (159), Expect = 3e-09 Identities = 33/39 (84%), Positives = 36/39 (92%), Gaps = 1/39 (2%) Frame = +1 Query: 1 VTHYSDPLMLAEISCGLGEAMVGLNL-DKNVERYASRSE 114 VTHYSDP +LAEISCGLGEAMVGLNL D NVER+A+RSE Sbjct: 272 VTHYSDPGLLAEISCGLGEAMVGLNLNDSNVERFANRSE 310 >sp|Q39963.1|PDX1_HEVBR RecName: Full=Probable pyridoxal biosynthesis protein PDX1; AltName: Full=Ethylene-inducible protein HEVER gi|1209317|gb|AAA91063.1| ethylene-inducible protein [Hevea brasiliensis] Length = 309 Score = 65.5 bits (158), Expect = 4e-09 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 1/39 (2%) Frame = +1 Query: 1 VTHYSDPLMLAEISCGLGEAMVGLNL-DKNVERYASRSE 114 VTHYSDP MLAE+SCGLGEAMVG+NL DK VER+A+RSE Sbjct: 271 VTHYSDPDMLAEVSCGLGEAMVGINLNDKKVERFANRSE 309 >ref|XP_002308219.1| predicted protein [Populus trichocarpa] gi|222854195|gb|EEE91742.1| predicted protein [Populus trichocarpa] Length = 309 Score = 65.5 bits (158), Expect = 4e-09 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 1/39 (2%) Frame = +1 Query: 1 VTHYSDPLMLAEISCGLGEAMVGLNL-DKNVERYASRSE 114 VTHYSDP +LAE+SCGLGEAMVGLNL DK VER+ASRS+ Sbjct: 271 VTHYSDPELLAEVSCGLGEAMVGLNLNDKKVERFASRSD 309 >ref|XP_003593782.1| Pyridoxal biosynthesis protein PDX1.3 [Medicago truncatula] gi|72256515|gb|AAZ67140.1| pyridoxine biosynthesis protein [Medicago truncatula] gi|355482830|gb|AES64033.1| Pyridoxal biosynthesis protein PDX1.3 [Medicago truncatula] Length = 314 Score = 65.1 bits (157), Expect = 6e-09 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 1/39 (2%) Frame = +1 Query: 1 VTHYSDPLMLAEISCGLGEAMVGLNL-DKNVERYASRSE 114 VTHYSDP +LAE+SCGLGEAMVGLNL D NVER+A+RSE Sbjct: 276 VTHYSDPEILAEVSCGLGEAMVGLNLTDHNVERFANRSE 314