BLASTX nr result
ID: Cnidium21_contig00010544
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00010544 (273 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524888.1| conserved hypothetical protein [Ricinus comm... 68 7e-10 >ref|XP_002524888.1| conserved hypothetical protein [Ricinus communis] gi|223535851|gb|EEF37512.1| conserved hypothetical protein [Ricinus communis] Length = 100 Score = 68.2 bits (165), Expect = 7e-10 Identities = 27/46 (58%), Positives = 30/46 (65%) Frame = +1 Query: 133 CNKHAKLSKKVAEFLCNTCLFSVCCPSSIFWCCLKLPCKIGWGTAK 270 C+K K AEF C+ CLF V CP I WCC+KLPCKIGW AK Sbjct: 8 CSKDTDCHHKAAEFACSACLFCVACPLCIVWCCVKLPCKIGWKAAK 53