BLASTX nr result
ID: Cnidium21_contig00010458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00010458 (911 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588347.1| NADH-ubiquinone oxidoreductase chain [Medica... 65 3e-08 ref|XP_002535452.1| conserved hypothetical protein [Ricinus comm... 64 6e-08 >ref|XP_003588347.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] gi|355477395|gb|AES58598.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] Length = 339 Score = 64.7 bits (156), Expect = 3e-08 Identities = 42/90 (46%), Positives = 44/90 (48%) Frame = -3 Query: 306 LMMKHNFYLSADDDVHSWLDALNEKELSRLRKNFLRN*AASFK*VGGRLCIVGVRRTADE 127 LMMK + LSADDDVHSW R I+G Sbjct: 25 LMMKQDPDLSADDDVHSWG-------------------------APDRRRIIGT------ 53 Query: 126 **VPPPQAEFVSRVIGDHFARFGGHLSQPP 37 P PQAE VSRVIGDHFARFGGHLSQPP Sbjct: 54 ---PTPQAELVSRVIGDHFARFGGHLSQPP 80 >ref|XP_002535452.1| conserved hypothetical protein [Ricinus communis] gi|223523063|gb|EEF26931.1| conserved hypothetical protein [Ricinus communis] Length = 55 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 1 QKLDRGQDAVGRRRLTQVPPEPREMVAYYTAH 96 QK DRGQDAVGRRRLTQVP EPREMVAYYTAH Sbjct: 24 QKWDRGQDAVGRRRLTQVPLEPREMVAYYTAH 55