BLASTX nr result
ID: Cnidium21_contig00010457
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00010457 (411 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313390.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_002525607.1| conserved hypothetical protein [Ricinus comm... 59 3e-07 ref|XP_002298321.1| predicted protein [Populus trichocarpa] gi|1... 58 7e-07 >ref|XP_002313390.1| predicted protein [Populus trichocarpa] gi|222849798|gb|EEE87345.1| predicted protein [Populus trichocarpa] Length = 90 Score = 59.7 bits (143), Expect = 2e-07 Identities = 31/64 (48%), Positives = 45/64 (70%) Frame = -2 Query: 338 LWDFVLGAIAKEEQLYEVDPLLQKVDGKPTSGTTGTRKSSVEVPPPKKESXXXXXXXGLF 159 L D++LG++ KE+Q YE DP+L+KV+ K + GTT R++SV VP KK++ GLF Sbjct: 30 LLDWILGSLQKEDQFYETDPILKKVEEKNSGGTTSGRRNSVAVPQKKKKN---GGFGGLF 86 Query: 158 AKKE 147 AKK+ Sbjct: 87 AKKD 90 >ref|XP_002525607.1| conserved hypothetical protein [Ricinus communis] gi|223535043|gb|EEF36725.1| conserved hypothetical protein [Ricinus communis] Length = 94 Score = 59.3 bits (142), Expect = 3e-07 Identities = 31/61 (50%), Positives = 42/61 (68%) Frame = -2 Query: 332 DFVLGAIAKEEQLYEVDPLLQKVDGKPTSGTTGTRKSSVEVPPPKKESXXXXXXXGLFAK 153 D+VLG + KE+Q YE DP+L+KV+ K + GTT RK+SV + P KK++ GLFAK Sbjct: 35 DWVLGNLTKEDQFYETDPILKKVEEKSSGGTTSGRKNSVSI-PQKKKNGGFGGFGGLFAK 93 Query: 152 K 150 K Sbjct: 94 K 94 >ref|XP_002298321.1| predicted protein [Populus trichocarpa] gi|118487200|gb|ABK95428.1| unknown [Populus trichocarpa] gi|222845579|gb|EEE83126.1| predicted protein [Populus trichocarpa] Length = 92 Score = 58.2 bits (139), Expect = 7e-07 Identities = 30/64 (46%), Positives = 41/64 (64%) Frame = -2 Query: 338 LWDFVLGAIAKEEQLYEVDPLLQKVDGKPTSGTTGTRKSSVEVPPPKKESXXXXXXXGLF 159 L D+++G++ KE+Q YE DP+L+KV+GK GT RK+SV VP KK GLF Sbjct: 33 LLDWIIGSLQKEDQFYETDPILKKVEGKNNGGTASGRKNSVAVPQKKKSG----GFGGLF 88 Query: 158 AKKE 147 AK + Sbjct: 89 AKND 92