BLASTX nr result
ID: Cnidium21_contig00010348
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00010348 (438 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531736.1| conserved hypothetical protein [Ricinus comm... 55 2e-11 >ref|XP_002531736.1| conserved hypothetical protein [Ricinus communis] gi|223528639|gb|EEF30656.1| conserved hypothetical protein [Ricinus communis] Length = 74 Score = 54.7 bits (130), Expect(2) = 2e-11 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -3 Query: 169 DRGLVVPASAAMQWKGRSLNQPPSLLISFFQRKK 68 DRGL+VPASAAMQWKGRSLN+PP SFF +KK Sbjct: 26 DRGLIVPASAAMQWKGRSLNRPP----SFFSKKK 55 Score = 39.3 bits (90), Expect(2) = 2e-11 Identities = 18/22 (81%), Positives = 21/22 (95%) Frame = -1 Query: 84 FFKEKSSTRRLDSRMRLSSYRP 19 F K+KSST+RLDSRMRLSS+RP Sbjct: 51 FSKKKSSTKRLDSRMRLSSHRP 72