BLASTX nr result
ID: Cnidium21_contig00010270
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00010270 (345 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ96022.1| predicted protein [Hordeum vulgare subsp. vulgare] 68 9e-10 ref|XP_002465403.1| hypothetical protein SORBIDRAFT_01g038060 [S... 66 3e-09 gb|AFW88659.1| hypothetical protein ZEAMMB73_209786 [Zea mays] 66 3e-09 ref|XP_003558118.1| PREDICTED: U2 small nuclear ribonucleoprotei... 66 3e-09 ref|NP_001169386.1| uncharacterized protein LOC100383254 [Zea ma... 66 3e-09 >dbj|BAJ96022.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 233 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -1 Query: 345 AFVEFEDENQSLVAMEALQGFKITPQNPMGISYAKK 238 AFVE+EDENQS+VAMEALQGFKI+P+NPM ISYAKK Sbjct: 198 AFVEYEDENQSMVAMEALQGFKISPENPMAISYAKK 233 >ref|XP_002465403.1| hypothetical protein SORBIDRAFT_01g038060 [Sorghum bicolor] gi|241919257|gb|EER92401.1| hypothetical protein SORBIDRAFT_01g038060 [Sorghum bicolor] Length = 233 Score = 66.2 bits (160), Expect = 3e-09 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -1 Query: 345 AFVEFEDENQSLVAMEALQGFKITPQNPMGISYAKK 238 AFVEFED++QS+VAM+ALQGFKITP+NPM ISYAKK Sbjct: 198 AFVEFEDDSQSMVAMQALQGFKITPENPMAISYAKK 233 >gb|AFW88659.1| hypothetical protein ZEAMMB73_209786 [Zea mays] Length = 61 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -1 Query: 345 AFVEFEDENQSLVAMEALQGFKITPQNPMGISYAKK 238 AFVEFED+ QS+VAM+ALQGFKITP+NPM ISYAKK Sbjct: 26 AFVEFEDDGQSMVAMQALQGFKITPENPMAISYAKK 61 >ref|XP_003558118.1| PREDICTED: U2 small nuclear ribonucleoprotein B''-like [Brachypodium distachyon] Length = 233 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -1 Query: 345 AFVEFEDENQSLVAMEALQGFKITPQNPMGISYAKK 238 AFVEFEDE+QS+VAM+ALQGFKI+P+NPM ISYAKK Sbjct: 198 AFVEFEDESQSMVAMQALQGFKISPENPMAISYAKK 233 >ref|NP_001169386.1| uncharacterized protein LOC100383254 [Zea mays] gi|224029017|gb|ACN33584.1| unknown [Zea mays] gi|414866361|tpg|DAA44918.1| TPA: hypothetical protein ZEAMMB73_448604 [Zea mays] Length = 233 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -1 Query: 345 AFVEFEDENQSLVAMEALQGFKITPQNPMGISYAKK 238 AFVEFED+ QS+VAM+ALQGFKITP+NPM ISYAKK Sbjct: 198 AFVEFEDDGQSMVAMQALQGFKITPENPMAISYAKK 233