BLASTX nr result
ID: Cnidium21_contig00010248
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00010248 (436 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277123.1| PREDICTED: PITH domain-containing protein 1 ... 59 4e-07 gb|ACH63232.1| hypothetical protein [Rheum australe] 56 3e-06 >ref|XP_002277123.1| PREDICTED: PITH domain-containing protein 1 [Vitis vinifera] gi|296081613|emb|CBI20618.3| unnamed protein product [Vitis vinifera] Length = 204 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 345 NEAVPGSVKSVFKAWEQRLSISEGHLESNE 434 NEAVPGSVKSVFKAWEQRL+ SEGHLESN+ Sbjct: 33 NEAVPGSVKSVFKAWEQRLNSSEGHLESND 62 >gb|ACH63232.1| hypothetical protein [Rheum australe] Length = 204 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 345 NEAVPGSVKSVFKAWEQRLSISEGHLESNE 434 NEAV GSVKSVF+AWEQRLS+SEG+LESNE Sbjct: 33 NEAVAGSVKSVFRAWEQRLSLSEGYLESNE 62