BLASTX nr result
ID: Cnidium21_contig00010169
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00010169 (958 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003551718.1| PREDICTED: uncharacterized amino acid permea... 97 6e-18 ref|XP_003534469.1| PREDICTED: uncharacterized amino acid permea... 97 6e-18 ref|XP_002272634.2| PREDICTED: uncharacterized amino acid permea... 96 1e-17 emb|CBI16645.3| unnamed protein product [Vitis vinifera] 96 1e-17 emb|CAN66397.1| hypothetical protein VITISV_020825 [Vitis vinifera] 96 1e-17 >ref|XP_003551718.1| PREDICTED: uncharacterized amino acid permease YhdG-like [Glycine max] Length = 560 Score = 97.1 bits (240), Expect = 6e-18 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = -2 Query: 147 GAFKVDVSNWTPFAPNGYKAVFTGATIVFFAYVGFDAVANSAEESKRPQ 1 GAF+VDVSNW+PFAPNG KA+FTGAT+VFFAYVGFDAVANSAEESKRPQ Sbjct: 226 GAFEVDVSNWSPFAPNGLKAIFTGATVVFFAYVGFDAVANSAEESKRPQ 274 >ref|XP_003534469.1| PREDICTED: uncharacterized amino acid permease YhdG-like [Glycine max] Length = 558 Score = 97.1 bits (240), Expect = 6e-18 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = -2 Query: 147 GAFKVDVSNWTPFAPNGYKAVFTGATIVFFAYVGFDAVANSAEESKRPQ 1 GAF+VDVSNW+PFAPNG KA+FTGAT+VFFAYVGFDAVANSAEESKRPQ Sbjct: 224 GAFEVDVSNWSPFAPNGLKAIFTGATVVFFAYVGFDAVANSAEESKRPQ 272 >ref|XP_002272634.2| PREDICTED: uncharacterized amino acid permease YhdG-like [Vitis vinifera] Length = 574 Score = 96.3 bits (238), Expect = 1e-17 Identities = 43/49 (87%), Positives = 48/49 (97%) Frame = -2 Query: 147 GAFKVDVSNWTPFAPNGYKAVFTGATIVFFAYVGFDAVANSAEESKRPQ 1 GAFKVDVSNW+PFAPNG++A+ TGAT+VFFAYVGFDAVANSAEESKRPQ Sbjct: 235 GAFKVDVSNWSPFAPNGFEAILTGATVVFFAYVGFDAVANSAEESKRPQ 283 >emb|CBI16645.3| unnamed protein product [Vitis vinifera] Length = 600 Score = 96.3 bits (238), Expect = 1e-17 Identities = 43/49 (87%), Positives = 48/49 (97%) Frame = -2 Query: 147 GAFKVDVSNWTPFAPNGYKAVFTGATIVFFAYVGFDAVANSAEESKRPQ 1 GAFKVDVSNW+PFAPNG++A+ TGAT+VFFAYVGFDAVANSAEESKRPQ Sbjct: 261 GAFKVDVSNWSPFAPNGFEAILTGATVVFFAYVGFDAVANSAEESKRPQ 309 >emb|CAN66397.1| hypothetical protein VITISV_020825 [Vitis vinifera] Length = 623 Score = 96.3 bits (238), Expect = 1e-17 Identities = 43/49 (87%), Positives = 48/49 (97%) Frame = -2 Query: 147 GAFKVDVSNWTPFAPNGYKAVFTGATIVFFAYVGFDAVANSAEESKRPQ 1 GAFKVDVSNW+PFAPNG++A+ TGAT+VFFAYVGFDAVANSAEESKRPQ Sbjct: 261 GAFKVDVSNWSPFAPNGFEAILTGATVVFFAYVGFDAVANSAEESKRPQ 309