BLASTX nr result
ID: Cnidium21_contig00008725
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00008725 (363 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003323038.1| hAT family dimerization domain-containing pr... 43 8e-07 ref|XP_003329237.1| hAT family dimerization domain-containing pr... 44 1e-06 >ref|XP_003323038.1| hAT family dimerization domain-containing protein [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 529 Score = 42.7 bits (99), Expect(2) = 8e-07 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 2/61 (3%) Frame = -1 Query: 189 RALYAKMVAKHDLSFLMAEYDYFLLWIS--YASYKHRSRNTVKSDLLGVYTAEKERIYKE 16 R L K +A HD F M E+ YF L+++ + +K +SR T K D + ++ + K + KE Sbjct: 120 RDLLIKTIAAHDYPFRMVEHKYFKLFVASLHPHFKLKSRFTAKDDCMALFQSMKGNLLKE 179 Query: 15 I 13 I Sbjct: 180 I 180 Score = 35.0 bits (79), Expect(2) = 8e-07 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -3 Query: 361 AICKYCHANFNGASDQGTSHLKNHTKTCR 275 A+C YC ++ +G S GT+HL H C+ Sbjct: 58 AVCNYCKSSLSGKSTSGTAHLWKHLDRCK 86 >ref|XP_003329237.1| hAT family dimerization domain-containing protein [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 655 Score = 43.9 bits (102), Expect(2) = 1e-06 Identities = 23/61 (37%), Positives = 34/61 (55%), Gaps = 2/61 (3%) Frame = -1 Query: 189 RALYAKMVAKHDLSFLMAEYDYFLLWIS--YASYKHRSRNTVKSDLLGVYTAEKERIYKE 16 R L KM+A HD F M ++ YF L++ + +K RSR T K D + ++ K + KE Sbjct: 122 RDLLVKMIAAHDYPFRMVQHKYFKLFVESLHPHFKVRSRFTAKDDCMALFQNMKGNLLKE 181 Query: 15 I 13 I Sbjct: 182 I 182 Score = 33.5 bits (75), Expect(2) = 1e-06 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -3 Query: 361 AICKYCHANFNGASDQGTSHLKNHTKTCR 275 A+C YC +G S GT+HL H C+ Sbjct: 60 AVCNYCKDQLSGKSTSGTAHLWKHLDRCK 88