BLASTX nr result
ID: Cnidium21_contig00008613
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00008613 (682 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269605.2| PREDICTED: homeobox-leucine zipper protein H... 73 6e-11 emb|CBI15277.3| unnamed protein product [Vitis vinifera] 68 1e-09 ref|XP_002271692.1| PREDICTED: homeobox-leucine zipper protein H... 68 1e-09 emb|CAN83969.1| hypothetical protein VITISV_039798 [Vitis vinifera] 68 1e-09 gb|ADL36709.1| HD domain class transcription factor [Malus x dom... 62 1e-07 >ref|XP_002269605.2| PREDICTED: homeobox-leucine zipper protein HAT5-like [Vitis vinifera] gi|296086435|emb|CBI32024.3| unnamed protein product [Vitis vinifera] Length = 321 Score = 72.8 bits (177), Expect = 6e-11 Identities = 33/63 (52%), Positives = 45/63 (71%) Frame = -1 Query: 682 SHFFDMDQSDMSQDEEENLRRLLLPSLAYMFPRIGDISSPDLPASTCSSGLPIEEEPYDF 503 S F+ DQS+ SQDEE+NL + L+P L FP++ D S PD PA+ C+ GLP EE+P+ F Sbjct: 261 SQIFEPDQSEFSQDEEDNLSKSLIPPLC--FPKLEDCSYPDPPANACNLGLPAEEQPFWF 318 Query: 502 WAY 494 W+Y Sbjct: 319 WSY 321 >emb|CBI15277.3| unnamed protein product [Vitis vinifera] Length = 263 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/63 (46%), Positives = 44/63 (69%) Frame = -1 Query: 682 SHFFDMDQSDMSQDEEENLRRLLLPSLAYMFPRIGDISSPDLPASTCSSGLPIEEEPYDF 503 S+ F+ DQSD+SQDEE+N + LLP +Y+FP++ D+ PD P + CS G P+E+ + Sbjct: 202 SYVFEADQSDVSQDEEDNFSKSLLPP-SYIFPKLEDVDYPDPPTNPCSFGFPVEDHAFWS 260 Query: 502 WAY 494 W+Y Sbjct: 261 WSY 263 >ref|XP_002271692.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Vitis vinifera] Length = 317 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/63 (46%), Positives = 44/63 (69%) Frame = -1 Query: 682 SHFFDMDQSDMSQDEEENLRRLLLPSLAYMFPRIGDISSPDLPASTCSSGLPIEEEPYDF 503 S+ F+ DQSD+SQDEE+N + LLP +Y+FP++ D+ PD P + CS G P+E+ + Sbjct: 256 SYVFEADQSDVSQDEEDNFSKSLLPP-SYIFPKLEDVDYPDPPTNPCSFGFPVEDHAFWS 314 Query: 502 WAY 494 W+Y Sbjct: 315 WSY 317 >emb|CAN83969.1| hypothetical protein VITISV_039798 [Vitis vinifera] Length = 333 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/63 (46%), Positives = 44/63 (69%) Frame = -1 Query: 682 SHFFDMDQSDMSQDEEENLRRLLLPSLAYMFPRIGDISSPDLPASTCSSGLPIEEEPYDF 503 S+ F+ DQSD+SQDEE+N + LLP +Y+FP++ D+ PD P + CS G P+E+ + Sbjct: 272 SYVFEADQSDVSQDEEDNFSKSLLPP-SYIFPKLEDVDYPDPPTNPCSFGFPVEDHAFWS 330 Query: 502 WAY 494 W+Y Sbjct: 331 WSY 333 >gb|ADL36709.1| HD domain class transcription factor [Malus x domestica] Length = 324 Score = 62.0 bits (149), Expect = 1e-07 Identities = 26/63 (41%), Positives = 43/63 (68%) Frame = -1 Query: 682 SHFFDMDQSDMSQDEEENLRRLLLPSLAYMFPRIGDISSPDLPASTCSSGLPIEEEPYDF 503 S+ F+ +QSD+SQDEE+N + +LP Y+FP+I D+ D PA++C+ P+E+ + Sbjct: 264 SYAFEPEQSDLSQDEEDNFTKSMLPP--YIFPKIEDVDYSDTPANSCNYAFPVEDHAFWS 321 Query: 502 WAY 494 W+Y Sbjct: 322 WSY 324